MAS1L Polyclonal antibody, PBS Only

• 

  IHC staining of human brain using 21029-1-AP (same clone as 21029-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 21029-1-AP (MAS1L Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21029-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 21029-1-AP (same clone as 21029-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 21029-1-AP (MAS1L Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21029-1-PBS in a different storage buffer formulation.

MAS1L Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 21029-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

21029-1-PBS targets MAS1L in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15337

  Product name: Recombinant human MAS1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-88 aa of BC069345

  Sequence: MVWGKICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETNETIHMQMSMAVGQQALPLNIIAPKAVLVSLC

• Full Name: MAS1 oncogene-like
• Calculated Molecular Weight: 378 aa, 42 kDa
• GenBank Accession Number: BC069345
• Gene Symbol: MAS1L
• Gene ID (NCBI): 116511
• RRID: AB_2878794
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35410
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.