MBD5 Polyclonal antibody

• 

  WB analysis of mouse heart using 15961-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 15961-1-AP (MBD5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 15961-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15961-1-AP (MBD5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skeletal muscle using 15961-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15961-1-AP (MBD5 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

MBD5 Polyclonal Antibody for WB, ELISA

Cat No. 15961-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF, IHC, ELISA

Synonyms

KIAA1461, MBD5, MRD1

---

Tested Applications

• Positive WB detected in: mouse heart tissue, human skeletal muscle tissue, mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

15961-1-AP targets MBD5 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8728

  Product name: Recombinant human MBD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-292 aa of BC014534

  Sequence: MPLNQILNQHNAASFPASSLLSAAAKAQLANQNKLAGNNSSSSSNSGAVAGSGNTEGHSTLNTMFPPTANMLLPTGEGQSGRAALRDKLMSQQKDALRKRKQPPTTVLSLLRQSQMDSSAVPKPGPDLLRKQGQGSFPISSMSQLLQSMSCQSSHLSSNSTPGCGASNTALPCSANQLHFTDPSMNSSVLQNIPLRGEAVHCHNANTNFVHSNSPVPNHHLAGLINQIQASGNCGMLSQSGMALGNSLHPNPPQSRISTSSTPVIPNSIVSSYNQTSSEAGMVLLEKSTQRY

• Full Name: methyl-CpG binding domain protein 5
• Calculated Molecular Weight: 292 aa, 31 kDa, 160 kDa
• Observed Molecular Weight: 160 kDa
• GenBank Accession Number: BC014534
• Gene Symbol: MBD5
• Gene ID (NCBI): 55777
• RRID: AB_2281588
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P267
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

In vertebrates, cytosine methylation in DNA is one of the major epigenetic modifications, which regulates many cellular events, including developmental gene expression, X chromosome inactivation, genome defense, and genomic imprinting. DNA methylation exerts regulatory functions by recruiting specific binding proteins that contain a highly conserved methyl-CpG binding domain (MBD) [PMID:12610534,16403636]. Methyl-CpG binding domain protein 5 (MBD5) belongs to the MBD family proteins, which play central roles in transcriptional regulation and development. It is a candidate gene involved in human 2q23.1 microdeletion syndrome [PMID:23077600].

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Low chorionic villous succinate accumulation associates with recurrent spontaneous abortion risk.; Authors - Xiao-Hui Wang ; KD Validated
human	WB	Genet Test Mol Biomarkers; The Expression of MBD6 Is Associated with Tumor Size in Uterine Leiomyomas.; Authors - Mei-Rong Liang
mouse	IHC	Cell Rep; Distinct Pathogenic Genes Causing Intellectual Disability and Autism Exhibit a Common Neuronal Network Hyperactivity Phenotype.; Authors - Monica Frega
human	IF	Int J Mol Sci; A Novel Genetic Variant in MBD5 Associated with Severe Epilepsy and Intellectual Disability: Potential Implications on Neural Primary Cilia; Authors - Mariana Martins