MBP Polyclonal antibody

MBP Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, ELISA
Cat No. 10458-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF-P, IF-Fro, ELISA

myelin basic protein

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue
Positive IF-Fro detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10458-1-AP targets MBP in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, rabbit
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0713

Product name: Recombinant human MBP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-171 aa of BC008749

Sequence: MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR

Predict reactive species
Full Name myelin basic protein
Calculated Molecular Weight 33 kDa
Observed Molecular Weight 14-23 kDa
GenBank Accession NumberBC008749
Gene Symbol Myelin basic protein
Gene ID (NCBI) 4155
RRIDAB_2250289
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02686
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MBP belongs to the myelin basic protein family. The classic group of MBP isoforms (isoform 4-isoform 14) are the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells. MBP has six isoforms. Catalog#10458-1-AP is capable of recognizing multiple isoforms of MBP.

Protocols

Product Specific Protocols
WB protocol for MBP antibody 10458-1-APDownload protocol
IHC protocol for MBP antibody 10458-1-APDownload protocol
IF protocol for MBP antibody 10458-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

ACS Nano

Neutrophil Nanovesicle Protects against Experimental Autoimmune Encephalomyelitis through Enhancing Myelin Clearance by Microglia

Authors - Shishi Shen
ratIF

ACS Nano

Supramolecular Hydrogel Microspheres of Platelet-Derived Growth Factor Mimetic Peptide Promote Recovery from Spinal Cord Injury

Authors - Weidong Wu
human,mouseIF

Nat Commun

Macrophage lineage cells-derived migrasomes activate complement-dependent blood-brain barrier damage in cerebral amyloid angiopathy mouse model

Authors - Mengyan Hu
ratIF

Microbiome

The microbiota-gut-brain axis participates in chronic cerebral hypoperfusion by disrupting the metabolism of short-chain fatty acids.

Authors - Weiping Xiao
mouseIHC

Brain

Sensory neurons have an axon initial segment that initiates spontaneous activity in neuropathic pain.

Authors - Ana I Nascimento
mouseIHC

J Pineal Res

Circadian misalignment impairs oligodendrocyte myelination via Bmal1 overexpression leading to anxiety and depression-like behaviors

Authors - Yao Zuo

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Samantha (Verified Customer) (08-29-2025)

Used in a Western Blot and detected myelin in human dorsal root ganglia and bound to recombinant myelin protein

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 in 1000
  • Cell Tissue Type: Human DRG tissue lysate, recombinant myelin protein
FH

Kenzo (Verified Customer) (08-16-2023)

This MBP antibody worked well and generated robust immunofluorescence signals on mouse optic nerve sections.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Mouse optic nerve
FH

Rebecca (Verified Customer) (02-10-2022)

Western performed on Biorad MiniPROTEAN 4-15% TGX precast gels and Precision Plus All Blue Protein Ladder and 4x Laemmli Sample Buffer. Blocking performed for 1h at room temperature using 5%BLOTTO. Primary antibody dilution was performed overnight at 4°C in 5%BLOTTO/0.05%Tween. Secondary antibody was LiCOR IRDye® 680RD Donkey anti-Mouse IgG (H + L) at 1:20000 dilution in PBS-Tween-SDS as per manufacturers instructions for 2h at room temperature. Blot showed clear bands of the expected isoform sizes with very low-none background/off target binding.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Rat brain whole tissue lysate (50ug)
MBP Antibody Western Blot validation (1:5000 dilution) in Rat brain whole tissue lysate (50ug) (Cat no:10458-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...