Product Information
68959-1-PBS targets MBTPS2 as part of a matched antibody pair:
MP50410-1: 68959-1-PBS capture and 68959-2-PBS detection (validated in Cytometric bead array)
MP50410-2: 68959-1-PBS capture and 68959-3-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag4390 Product name: Recombinant human MBTPS2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 229-330 aa of BC036465 Sequence: VLALLGILALVLLPVILLPFYYTGVGVLITEVAEDSPAIGPRGLFVGDLVTHLQDCPVTNVQDWNECLDTIAYEPQIGYCISASTLQQLSFPVRGVYISSI Predict reactive species |
Full Name | membrane-bound transcription factor peptidase, site 2 |
Calculated Molecular Weight | 36 kDa, 57 kDa |
GenBank Accession Number | BC036465 |
Gene Symbol | MBTPS2 |
Gene ID (NCBI) | 51360 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | O43462 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |