MC3R Polyclonal antibody, PBS Only

• 

  IHC staining of mouse brain using 21027-1-AP (same clone as 21027-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21027-1-AP (MC3R antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21027-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 21027-1-AP (same clone as 21027-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 21027-1-AP (MC3R Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21027-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 21027-1-AP (same clone as 21027-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 21027-1-AP (MC3R Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21027-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 21027-1-AP (same clone as 21027-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21027-1-AP (MC3R antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21027-1-PBS in a different storage buffer formulation.

MC3R Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 21027-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

21027-1-PBS targets MC3R in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15292

  Product name: Recombinant human MC3R protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-90 aa of BC069599

  Sequence: MSIQKTYLEGDFVFPVSSSSFLRTLLEPQLGSALLTAMNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSL

• Full Name: melanocortin 3 receptor
• Calculated Molecular Weight: 360 aa, 40 kDa
• GenBank Accession Number: BC069599
• Gene Symbol: MC3R
• Gene ID (NCBI): 4159
• RRID: AB_2878792
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P41968
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.