MCM2 Monoclonal antibody

• 

  WB analysis using 66204-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66204-1-Ig (MCM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 66204-1-Ig

  WB result of MCM2 antibody (66204-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MCM2 transfected HEK-293 cells.

• 

  WB analysis of 4T1 using 66204-1-Ig

  4T1 cells were subjected to SDS PAGE followed by western blot with 66204-1-Ig (MCM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 66204-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 66204-1-Ig (MCM2 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 66204-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66204-1-Ig (MCM2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 66204-1-Ig

  A431 cells were subjected to SDS PAGE followed by western blot with 66204-1-Ig (MCM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of Human tonsillitis using 66204-1-Ig

  Immunohistochemical analysis of paraffin-embedded Human tonsillitis tissue slide using 66204-1-Ig (MCM2 antibody) at dilution of 1:2000 (under 20x lens).

• 

  IHC staining of Human tonsillitis using 66204-1-Ig

  Immunohistochemical analysis of paraffin-embedded Human tonsillitis tissue slide using 66204-1-Ig (MCM2 antibody) at dilution of 1:2000 (under 20x lens).

• 

  IHC staining of human prostate cancer using 66204-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66204-1-Ig (MCM2 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 66204-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66204-1-Ig (MCM2 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

MCM2 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66204-1-Ig

Clone No.1F4D10

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

1F4D10, BM28, CCNL1, CDCL1, EC:3.6.4.12

---

Tested Applications

• Positive WB detected in: HeLa cells, K-562 cells, HEK-293 cells, A431 cells, 4T1 cells, A549 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells
• Positive IHC detected in: Human tonsillitis tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

66204-1-Ig targets MCM2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0798

  Product name: Recombinant human MCM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 657-904 aa of BC007670

  Sequence: FDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF

• Full Name: minichromosome maintenance complex component 2
• Calculated Molecular Weight: 102 kDa
• Observed Molecular Weight: 116-125 kDa
• GenBank Accession Number: BC007670
• Gene Symbol: MCM2
• Gene ID (NCBI): 4171
• RRID: AB_2881595
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P49736
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Cell Death Discov; MCM2 promotes the stemness and sorafenib resistance of hepatocellular carcinoma cells via hippo signaling; Authors - Xin Zhou