MCM2 Monoclonal antibody, PBS Only

• 

  WB analysis using 66204-1-Ig (same clone as 66204-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66204-1-Ig (MCM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66204-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66204-1-Ig (same clone as 66204-1-PBS)

  WB result of MCM2 antibody (66204-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MCM2 transfected HEK-293 cells. This data was developed using the same antibody clone with 66204-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 66204-1-Ig (same clone as 66204-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 66204-1-Ig (MCM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66204-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 4T1 using 66204-1-Ig (same clone as 66204-1-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 66204-1-Ig (MCM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66204-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 66204-1-Ig (same clone as 66204-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 66204-1-Ig (MCM2 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66204-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66204-1-Ig (same clone as 66204-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66204-1-Ig (MCM2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66204-1-PBS in a different storage buffer formulation.

• 

  IHC staining of Human tonsillitis using 66204-1-Ig (same clone as 66204-1-PBS)

  Immunohistochemical analysis of paraffin-embedded Human tonsillitis tissue slide using 66204-1-Ig (MCM2 antibody) at dilution of 1:2000 (under 20x lens). This data was developed using the same antibody clone with 66204-1-PBS in a different storage buffer formulation.

• 

  IHC staining of Human tonsillitis using 66204-1-Ig (same clone as 66204-1-PBS)

  Immunohistochemical analysis of paraffin-embedded Human tonsillitis tissue slide using 66204-1-Ig (MCM2 antibody) at dilution of 1:2000 (under 20x lens). This data was developed using the same antibody clone with 66204-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 66204-1-Ig (same clone as 66204-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66204-1-Ig (MCM2 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66204-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 66204-1-Ig (same clone as 66204-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66204-1-Ig (MCM2 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66204-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MCM2 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66204-1-PBS

Clone No.1F4D10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

1F4D10, BM28, CCNL1, CDCL1, EC:3.6.4.12

---

Product Information

66204-1-PBS targets MCM2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0798

  Product name: Recombinant human MCM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 657-904 aa of BC007670

  Sequence: FDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF

• Full Name: minichromosome maintenance complex component 2
• Calculated Molecular Weight: 102 kDa
• Observed Molecular Weight: 116-125 kDa
• GenBank Accession Number: BC007670
• Gene Symbol: MCM2
• Gene ID (NCBI): 4171
• RRID: AB_2881595
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P49736
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.