MDFIC Polyclonal antibody

• 

  IP experiment of Kasumi-1 using 31740-1-AP

  IP result of anti-MDFIC (IP:31740-1-AP, 4ug; Detection:31740-1-AP 1:500) with Kasumi-1 cells lysate 1320 ug.

• 

  IF Staining of HEK-293 using 31740-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using MDFIC antibody (31740-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

MDFIC Polyclonal Antibody for IF/ICC, IP, ELISA

Cat No. 31740-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, IP, ELISA

Synonyms

HIC, I-mfa domain-containing protein, LMPHM12, MyoD family inhibitor domain-containing protein

---

Tested Applications

• Positive IP detected in: Kasumi-1 cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31740-1-AP targets MDFIC in IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35437

  Product name: Recombinant human MDFIC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-170 aa of NM_001166345

  Sequence: MSGAGEALAPGPVGPQRVAEAGGGQLGSTAQGKCDKDNTEKDITQATNSHFTHGEMQDQSIWGNPSDGELIRTQPQRLPQLQTSAQVPSGEEIGKIKNGHTGLSNGNGIHHGAKHGSADNRKLSAPVSQKMHRKIQSSLSVNSDISKKSKVNAVFSQKTGSSPEDCCVHC

• Full Name: MyoD family inhibitor domain containing
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: NM_001166345
• Gene Symbol: MDFIC
• Gene ID (NCBI): 29969
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9P1T7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MDFIC encodes the MyoD family inhibitor domain containing protein, a 246-amino acid protein documented to regulate the activity of transcription factors including the glucocorticoid recep tor (GR), HAND1, and T cell factor/lymphoid enhancer factor (TCF/LEF) family members. The C-terminal region of MDFIC harbors a domain extremely rich in cysteine residues, reported to mediate protein-protein interactions between MDFIC and transcription factor componentry (PMID: 35235341).