• Featured Product
  • KD/KO Validated

Midkine Polyclonal antibody

Midkine Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 11009-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

MDK, Neurite outgrowth-promoting protein, Neurite outgrowth-promoting factor 2, Amphiregulin-associated protein

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse embryo tissue, COLO 320 cells, SH-SY5Y cells
Positive IP detected inmouse embryo tissue
Positive IHC detected inhuman intrahepatic cholangiocarcinoma tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11009-1-AP targets Midkine in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1465

Product name: Recombinant human MDK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-143 aa of BC011704

Sequence: MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Predict reactive species
Full Name midkine (neurite growth-promoting factor 2)
Calculated Molecular Weight 16 kDa
Observed Molecular Weight16 kDa
GenBank Accession NumberBC011704
Gene Symbol Midkine
Gene ID (NCBI) 4192
RRIDAB_2250619
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP21741
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Midkine is a heparin-binding growth factor identified over 20 years ago and enhances the survival, migration and many other activities of target cells. Midkine is rich in both basic amino acids and cysteine, and is not related to most other growth factors/cytokines. It is strongly expressed during embryonic periods, especially at the midgestation stage, and plays important roles in development, especially in neurogenesis. Midkine expression in adult tissue is generally weak or undetectable, and it is induced upon injury and exerts many activities related to tissue repair. The biological activities of midkine in malignant tumors include proliferation, angiogenesis, invasion and metastasis. Various cancers express significantly higher levels of the midkine protein in early stage tumor tissues than in adjacent normal tissue.

Protocols

Product Specific Protocols
WB protocol for Midkine antibody 11009-1-APDownload protocol
IHC protocol for Midkine antibody 11009-1-APDownload protocol
IF protocol for Midkine antibody 11009-1-APDownload protocol
IP protocol for Midkine antibody 11009-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Int J Mol Sci

Identification of Overexpressed Genes in Malignant Pleural Mesothelioma.

Authors - Federica Morani
humanWB,IHC,IF

Front Immunol

Roles of the m6A Modification of RNA in the Glioblastoma Microenvironment as Revealed by Single-Cell Analyses.

Authors - Feng Yuan
  • KD Validated
humanWB

Front Oncol

Targeting MDK Abrogates IFN-γ-Elicited Metastasis inCancers of Various Origins.

Authors - Luyu Zheng
humanWB

Cancer Cell Int

Midkine promotes glioblastoma progression via PI3K-Akt signaling.

Authors - Beiquan Hu
  • KD Validated

Am J Respir Cell Mol Biol

Mesenchymal Glucocorticoid Receptor Regulates Development of Multiple Cell Layers of the Mouse Lung.

Authors - Bird A Daniel AD
ratIHC

J Mol Neurosci

Electroacupuncture Alleviated Neuronal Apoptosis Following Ischemic Stroke in Rats via Midkine and ERK/JNK/p38 Signaling Pathway.

Authors - Ying Xing
Loading...
||
New chat Able
正在加载,请稍候...