MERTK Polyclonal antibody

• 

MERTK Polyclonal Antibody for ELISA

Cat No. 24491-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

c mer, MER, MERTK, Proto oncogene c Mer, Receptor tyrosine kinase MerTK, RP38, Tyrosine protein kinase Mer

---

Product Information

24491-1-AP targets MERTK in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17401

  Product name: Recombinant human MERTK protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-329 aa of BC114918

  Sequence: MKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINIKAIPSPPTEVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQALANYSIGVSCMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGYRISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTKGGVGPFSDPVKIFIPAHGWVDYAPSSTPAPGNADPVLII

• Full Name: c-mer proto-oncogene tyrosine kinase
• Calculated Molecular Weight: 999 aa, 110 kDa
• GenBank Accession Number: BC114918
• Gene Symbol: MERTK
• Gene ID (NCBI): 10461
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12866
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.