Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IF | See 1 publications below |
Product Information
30555-1-AP targets MFSD2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33064 Product name: Recombinant human MFSD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 170-219 aa of BC092414 Sequence: MFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSS Predict reactive species |
| Full Name | major facilitator superfamily domain containing 2 |
| Calculated Molecular Weight | 543 aa, 60 kDa |
| Observed Molecular Weight | 55-60 kDa |
| GenBank Accession Number | BC092414 |
| Gene Symbol | MFSD2 |
| Gene ID (NCBI) | 84879 |
| RRID | AB_3086361 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8NA29 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MFSD2 is a transmembrane protein and sodium-dependent lysophosphatidylcholine transporter. MFSD2 is involved in the establishment of the blood-brain barrier and is required for brain growth and function.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for MFSD2 antibody 30555-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Carcinog MFSD2A Overexpression Inhibits Hepatocellular Carcinoma Through TGF-β/Smad Signaling | ||
Bioeng Transl Med Sound conditioning strategy promoting paracellular permeability of the blood-labyrinth-barrier benefits inner ear drug delivery |

