MGAT5B Polyclonal antibody, PBS Only

• 

  WB analysis of HepG2 using 16993-1-AP (same clone as 16993-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16993-1-AP (MGAT5B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16993-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 16993-1-AP (same clone as 16993-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 16993-1-AP (MGAT5B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16993-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 16993-1-AP (same clone as 16993-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 16993-1-AP (MGAT5B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16993-1-PBS in a different storage buffer formulation.

• 

  WB analysis of C6 using 16993-1-AP (same clone as 16993-1-PBS)

  C6 cells were subjected to SDS PAGE followed by western blot with 16993-1-AP (MGAT5B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16993-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 16993-1-AP (same clone as 16993-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16993-1-AP (MGAT5B antibody) at dilution of 1:1600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16993-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 16993-1-AP (same clone as 16993-1-PBS)

  IP result of anti-MGAT5B (IP:16993-1-AP, 4ug; Detection:16993-1-AP 1:700) with Jurkat cells lysate 3600ug. This data was developed using the same antibody clone with 16993-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 16993-1-AP (same clone as 16993-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16993-1-AP (MGAT5B antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16993-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 16993-1-AP (same clone as 16993-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16993-1-AP (MGAT5B antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16993-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 16993-1-AP (same clone as 16993-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16993-1-AP (MGAT5B antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16993-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 16993-1-AP (same clone as 16993-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16993-1-AP (MGAT5B antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16993-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 16993-1-AP (same clone as 16993-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HepG2 cells using 16993-1-AP (MGAT5B antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16993-1-PBS in a different storage buffer formulation.

MGAT5B Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 16993-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

16993-1-PBS targets MGAT5B in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10678

  Product name: Recombinant human MGAT5B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-394 aa of BC062354

  Sequence: MITVNPDGKIMVRRCLVTLRPFRLFVLGIGFFTLCFLMTSLGGQFSARRLGDSPFTIRTEVMGGPESRGVLRKMSDLLELMVKRMDALARLENSSELHRAGGDLHFPADRMPPGAGLMERIQAIAQNVSDIAVKVDQILRHSLLLHSKVSEGRRDQCEAPSDPKFPDCSGKVEWMRARWTSDPCYAFFGVDGTECSFLIYLSEVEWFCPPLPWRNQTAAQRAPKPLPKVQAVFRSNLSHLLDLMGSGKESLIFMKKRTKRLTAQWALAAQRLAQKLGATQRDQKQILVHIGFLTEESGDVFSPRVLKGGPLGEMVQWADILTALYVLGHGLRVTVSLKELQRQRRLRSSQEQARCGVMGACEKMLLEGDVASNTLLIEKPSKKETEKCPKNLVT

• Full Name: mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, isozyme B
• Calculated Molecular Weight: 394 aa, 44 kDa, 89 kDa
• Observed Molecular Weight: 89-100 kDa
• GenBank Accession Number: BC062354
• Gene Symbol: MGAT5B
• Gene ID (NCBI): 146664
• RRID: AB_10858919
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q3V5L5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.