MZB1 Polyclonal antibody

• 

  WB analysis of Raji using 11454-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 11454-1-AP (MZB1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 11454-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 11454-1-AP (MZB1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human gliomas using 11454-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas using 11454-1-AP (MZB1 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human small intestine using 11454-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine slide using 11454-1-AP (MZB1 Antibody) at dilution of 1:50.

• 

  IHC staining of human small intestine using 11454-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine slide using 11454-1-AP (MZB1 Antibody) at dilution of 1:50.

MZB1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11454-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF, IHC, ELISA

Synonyms

hypothetical protein MGC29506, MZB1, PACAP, pERp1

---

Tested Applications

• Positive WB detected in: Raji cells
• Positive IHC detected in: human gliomas tissue, human small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 6 publications below
• IF: See 2 publications below

Product Information

11454-1-AP targets MZB1 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2015

  Product name: Recombinant human MZB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-189 aa of BC021275

  Sequence: MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL

• Full Name: hypothetical protein MGC29506
• Calculated Molecular Weight: 189 aa, 21 kDa
• Observed Molecular Weight: 19-21 kDa
• GenBank Accession Number: BC021275
• Gene Symbol: MZB1
• Gene ID (NCBI): 51237
• RRID: AB_832820
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WU39
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MZB1, also named as ,PACAP, MGC29506 and pERp1, belongs to the PERP1 family. It is associates with immunoglobulin M (IgM) heavy and light chains and promotes IgM assembly and secretion. MGC29506(PACAP) may exert its effect by acting as a molecular chaperone or as an oxidoreductase as it displays a low level of oxidoreductase activity. Isoform 2 may be involved in regulation of apoptosis. (PubMed: 11350957) MZB1 has 5 isoforms with MW 21kd and 7-13kd.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Clin Cancer Res; Integrative array-based approach identifies MZB1 as a frequently methylated putative tumor suppressor in hepatocellular carcinoma.; Authors - Matsumura Satoshi S
human	IHC,IF	J Pathol; Proteomic profiling identifies novel diagnostic biomarkers and molecular subtypes for mucinous tubular and spindle cell carcinoma of the kidney.; Authors - Huiya Xu
human	IHC	Int J Cancer; Epigenetic suppression of the immunoregulator MZB1 is associated with the malignant phenotype of gastric cancer.; Authors - Mitsuro Kanda
human	WB	J Biol Chem; Transgenic expression of microRNA-185 causes a developmental arrest of T cells by targeting multiple genes including Mzb1.; Authors - Belkaya Serkan S
human	WB,IHC,IF	Arthritis Res Ther; Increase of MZB1 in B cells in systemic lupus erythematosus: proteomic analysis of biopsied lymph nodes.; Authors - Aya Miyagawa-Hayashino
human	IHC	Oncol Lett; MZB1 expression indicates poor prognosis in estrogen receptor-positive breast cancer.; Authors - Manabu Watanabe