• Featured Product
  • KD/KO Validated

MGMT Polyclonal antibody

MGMT Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA
Cat No. 17195-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, FC (Intra), IP, CoIP, ELISA

O-6-methylguanine-DNA-alkyltransferase, Methylated-DNA--protein-cysteine methyltransferase, EC:2.1.1.63, 6-O-methylguanine-DNA methyltransferase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, MCF-7 cells, HeLa cells, Raji cells
Positive IP detected inJurkat cells
Positive IHC detected inhuman liver cancer tissue, human placenta tissue, human spleen tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17195-1-AP targets MGMT in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9996

Product name: Recombinant human MGMT protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-207 aa of BC000824

Sequence: MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN

Predict reactive species
Full Name O-6-methylguanine-DNA methyltransferase
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC000824
Gene Symbol MGMT
Gene ID (NCBI) 4255
RRIDAB_2143221
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP16455
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MGMT is the primary vehicle for cellular removal of alkyl lesions from the O-6 position of guanine and the O-4 position of thymine. While key to the maintenance of genomic integrity, MGMT also removes damage induced by alkylating chemotherapies, inhibiting the efficacy of cancer treatment [PMID:23065697].MGMT is the primary mechanism for the removal of alkylation damage from the O-6 position of guanine [PMID: 17482892]. The O-6 position of guanine is one of several positions in DNA bases to which alkyl groups are attached in SN1 alkylation reactions, and this repair has been well-characterized in mammalian cells and via MGMT homologs in bacteria and Archaea.[PMID: 10767620]

Protocols

Product Specific Protocols
FC protocol for MGMT antibody 17195-1-APDownload protocol
IHC protocol for MGMT antibody 17195-1-APDownload protocol
IP protocol for MGMT antibody 17195-1-APDownload protocol
WB protocol for MGMT antibody 17195-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Res

DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling.

Authors - Pengli Zheng
humanWB

Nucleic Acids Res

KDM6B promotes PARthanatos via suppression of O6-methylguanine DNA methyltransferase repair and sustained checkpoint response.

Authors - Mingming Yang
humanWB

Clin Transl Med

LncRNA BC promotes lung adenocarcinoma progression by modulating IMPAD1 alternative splicing

Authors - Qi Wen Chen
human,mouseWB,IHC

J Pharm Anal

MGMT activated by Wnt pathway promotes cisplatin tolerance through inducing slow-cycling cells and nonhomologous end joining in colorectal cancer

Authors - Haowei Zhang
  • KD Validated
humanWB

Oncogene

GBP3 promotes glioblastoma resistance to temozolomide by enhancing DNA damage repair.

Authors - Hui Xu
humanIHC

Oncogenesis

GSK3β palmitoylation mediated by ZDHHC4 promotes tumorigenicity of glioblastoma stem cells in temozolomide-resistant glioblastoma through the EZH2-STAT3 axis.

Authors - Chenggang Zhao
Loading...
||
New chat Able
正在加载,请稍候...