Tested Applications
| Positive WB detected in | HCT 116 cells, HEK-293 cells, L02 cells, mouse heart tissue |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31561-1-AP targets MIC10 in WB, IF/ICC, ELISA applications and shows reactivity with Human, Mouse samples.
| Tested Reactivity | Human, Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34301 Product name: Recombinant human MIC10 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 2-78 aa of NM_001032363 Sequence: SESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ Predict reactive species |
| Full Name | chromosome 1 open reading frame 151 |
| Calculated Molecular Weight | 9 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | NM_001032363 |
| Gene Symbol | C1orf151 |
| Gene ID (NCBI) | 440574 |
| RRID | AB_3670036 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q5TGZ0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MIC10, also known as C1orf151, MICOS10, and MINOS1, belongs to the MICOS complex subunit Mic10 family. MIC10 is a component of the MICOS complex, which is a large protein complex located in the inner membrane of mitochondria. MIC10 plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. MIC10 is also functionally connected to the F1Fo-ATP synthase (PMID: 22114354, PMID: 28315355).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MIC10 antibody 31561-1-AP | Download protocol |
| WB protocol for MIC10 antibody 31561-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



