Tested Applications
| Positive WB detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 7 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
15764-1-AP targets MID1IP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8400 Product name: Recombinant human MID1IP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-183 aa of BC008908 Sequence: MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH Predict reactive species |
| Full Name | MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) |
| Calculated Molecular Weight | 183 aa, 20 kDa |
| Observed Molecular Weight | 23 kDa, 46 kDa |
| GenBank Accession Number | BC008908 |
| Gene Symbol | MID1IP1 |
| Gene ID (NCBI) | 58526 |
| RRID | AB_2878181 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NPA3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MID1IP1, also named as Mid1-interacting protein 1 or Gastrulation-specific G12-like protein, is a 183 amino acid protein, which belongs to the SPOT14 family. MID1IP1 plays a role in the regulation of lipogenesis in liver. MID1IP1 may localizes in the nucleus and cytoplasm. MID1IP1 may form Homodimer in the absence of THRSP.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for MID1IP1 antibody 15764-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int J Mol Sci Acetylcorynoline Induces Apoptosis and G2/M Phase Arrest through the c-Myc Signaling Pathway in Colon Cancer Cells | ||
Biomolecules Inhibition of CNOT2 Induces Apoptosis via MID1IP1 in Colorectal Cancer Cells by Activating p53.
| ||
Cells Colocalization of MID1IP1 and c-Myc is Critically Involved in Liver Cancer Growth via Regulation of Ribosomal Protein L5 and L11 and CNOT2.
| ||
Int J Mol Sci Circaea mollis Siebold & Zucc. Induces Apoptosis in Colorectal Cancer Cells by Inhibiting c-Myc Through the Mediation of RPL5 | ||
Int J Mol Sci The Antitumor Effect of Timosaponin A3 through c-Myc Inhibition in Colorectal Cancer Cells and Combined Treatment Effect with 5-FU or Doxorubicin | ||
Front Pharmacol Ophiopogonin D increase apoptosis by activating p53 via ribosomal protein L5 and L11 and inhibiting the expression of c-Myc via CNOT2 |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH kay (Verified Customer) (10-01-2022) | Very effective
|



