MIF Polyclonal antibody

• 

  WB analysis using 20415-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20415-1-AP (MIF antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 20415-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20415-1-AP (MIF antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 20415-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20415-1-AP (MIF antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 20415-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20415-1-AP (MIF antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 20415-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20415-1-AP (MIF antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Y79 using 20415-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 20415-1-AP (MIF antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U-937 using 20415-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 20415-1-AP (MIF antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse spleen using 20415-1-AP

  IP result of anti-MIF (IP:20415-1-AP, 4ug; Detection:20415-1-AP 1:1000) with mouse spleen tissue lysate 4000ug.

• 

  IF Staining of U-251 using 20415-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using MIF antibody (20415-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  FC experiment of THP-1 using 20415-1-AP

  1X10^6 THP-1 cells were intracellularly stained with 0.4 ug Anti-Human MIF (20415-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

MIF Polyclonal Antibody for WB, IF/ICC, FC (Intra), IP, ELISA

Cat No. 20415-1-AP

Publications(27)

Reviews (5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), IP, ELISA

Synonyms

Macrophage migration inhibitory factor, L-dopachrome tautomerase, L-dopachrome isomerase, Glycosylation-inhibiting factor, EC:5.3.3.12

---

Tested Applications

• Positive WB detected in: A549 cells, U-937 cells, Y79 cells, HL-60 cells, Jurkat cells, U-87 MG cells, HEK-293T cells, HUVEC cells, J774A.1 cells, Neuro-2a cells, mouse spleen tissue, rat spleen tissue
• Positive IP detected in: mouse spleen tissue
• Positive IF/ICC detected in: U-251 cells
• Positive FC (Intra) detected in: THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 6 publications below
• WB: See 16 publications below
• IF: See 9 publications below

Product Information

20415-1-AP targets MIF in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14058

  Product name: Recombinant human MIF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 51-115 aa of BC000447

  Sequence: GGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

• Full Name: macrophage migration inhibitory factor (glycosylation-inhibiting factor)
• Calculated Molecular Weight: 115 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC000447
• Gene Symbol: MIF
• Gene ID (NCBI): 4282
• RRID: AB_10694820
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14174
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MIF is a pleiotropic cytokine that contributes to the pathogenesis of many autoimmune diseases through its upstream immunoregulatory function and its polymorphic genetic locus. MIF is a highly conserved protein of 12.5 kDa, with evolutionarily ancient homologues in plants, protozoans, nematodes, and invertebrates.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Stem Cell Res Ther; DPSCs regulate epithelial-T cell interactions in oral submucous fibrosis; Authors - S Y Wang
mouse	WB	Am J Pathol; CDR1as Deficiency Prevents Photoreceptor Degeneration by Regulating miR-7a-5p/α-syn/Parthanatos Pathway in Retinal Detachment; Authors - Feiyu Jin
human	WB	Cancer Lett; Macrophage migration inhibitory factor promotes tumor aggressiveness of esophageal squamous cell carcinoma via activation of Akt and inactivation of GSK3β.; Authors - Rui-Min Liu ; KD Validated
human	WB	Cell Prolif; TSP50 promotes hepatocyte proliferation and tumour formation by activating glucose-6-phosphate dehydrogenase (G6PD).; Authors - Xiaojun Zhang
mouse	WB	Front Endocrinol (Lausanne); Exercise prevents fatal stress-induced myocardial injury in obese mice; Authors - Yaoshan Dun
mouse	IF	Food Chem Toxicol; The crosstalk between M1 macrophage polarization and energy metabolism disorder contributes to polystyrene nanoplastics-triggered testicular inflammation; Authors - Siwen Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Tianyi (Verified Customer) (01-12-2024)

Antigen retrieval in TE buffer, incubated with AF594 for 2 h at RT

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:200
• Cell Tissue Type: Ovarian tissue

MIF Antibody Immunofluorescence validation (1:200 dilution) in Ovarian tissue (Cat no:20415-1-AP)

FH

sarah (Verified Customer) (10-27-2023)

antibody worked great for WB

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: 293T, HCT116

FH

Sarah (Verified Customer) (01-24-2023)

This antibody worked well despite low protein concentration.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HCT116

FH

Emma (Verified Customer) (03-15-2022)

Nice antibody have used overnight @ 1:1000 on cell lysates and conditioned media. Produces a band at the correct size.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: PC3

FH

Ryan (Verified Customer) (02-27-2019)

Tissue was fixed in PFA with no additional antigen retrieval. Co-localisation with microglia based on known markers (not shown).

• Applications: Immunohistochemistry, Immunofluorescence,
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: Zebrafish brain (Microglia) at 3dpf

MIF Antibody Immunohistochemistry,Immunofluorescence, validation (1:100 dilution) in Zebrafish brain (Microglia) at 3dpf (Cat no:20415-1-AP)