Tested Applications
Positive WB detected in | A549 cells, Jurkat cells, mouse heart tissue, rat skin tissue, NIH/3T3 cells |
Positive IP detected in | mouse heart tissue |
Positive IHC detected in | mouse skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 32 publications below |
IF | See 5 publications below |
Product Information
13092-1-AP targets MITF in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag3679 Product name: Recombinant human MITF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC012503 Sequence: MLEMLEYNHYQVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEFMKQ Predict reactive species |
Full Name | microphthalmia-associated transcription factor |
Calculated Molecular Weight | 91 aa, 10 kDa, 59 kDa |
Observed Molecular Weight | 59-65 kDa |
GenBank Accession Number | BC012503 |
Gene Symbol | MITF |
Gene ID (NCBI) | 4286 |
RRID | AB_10597698 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O75030 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The retinal pigment epithelium (RPE) has a essential role in maintaining visual function and dedifferentiation of RPE contributes to the pathophysiology of several ocular diseases[PMID: 22523078]. Microphthalmia-associated transcription factor (MITF) is a key regulator of RPE differentiation that is also down-regulated in dedifferentiated hfRPE cells. MITF is a basic helix-loop-helix (hHLH)-leucine zipper protein that involves in the development of various cell types, including neural crest-derived melanocytes and optic cup-derived retinal pigment epithelial cells [PMID: 10578055].
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MITF antibody 13092-1-AP | Download protocol |
IHC protocol for MITF antibody 13092-1-AP | Download protocol |
IP protocol for MITF antibody 13092-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Death Differ Lysine methylation of PPP1CA by the methyltransferase SUV39H2 disrupts TFEB-dependent autophagy and promotes intervertebral disc degeneration | ||
J Clin Invest mTORC1 feedback to AKT modulates lysosomal biogenesis through MiT/TFE regulation. | ||
Theranostics TFE3, a potential therapeutic target for Spinal Cord Injury via augmenting autophagy flux and alleviating ER stress. | ||
Phytomedicine Taxifolin inhibits melanoma proliferation/migration impeding USP18/Rac1/JNK/β-catenin oncogenic signaling | ||
Pigment Cell Melanoma Res D-tyrosine negatively regulates melanin synthesis by competitively inhibiting tyrosinase activity. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Eva (Verified Customer) (07-01-2025) | The antibody is functional both with and without antigen retrieval (AR: 110ºC for 1 min, a second cycle of 90ºC for 10s, in a citrate buffer 10mM pH=6); however, signal specificity appears reduced when antigen retrieval is applied, and its use is therefore not recommended. After x3 PBST (PBS + 0,2% Tween) washes, cryostat sample slides were incubated 2 hours with blocking buffer (PBST 0,2% + 5% FBS + 1% BSA) at Room Temperature (RT). The primary antibody was diluted 1:500 in Blocking Buffer and incubated with the samples overnight at 4 °C. Next day, wash x3 with PBST 0,2%, and incubate second antibody with fluorocrome at 1:500 2-3 hours at RT. Some background staining is observed, likely due to a high concentration of the secondary antibody, as it does not correspond to a specific signal. The staining is specifically localized in nuclei of pigmented cells, as expected, and no nonspecific signal is detected in other tissue types within the sample.
![]() |
FH Alessandro (Verified Customer) (11-06-2022) | no unspecific staining, great outcome
|