MKRN3 Polyclonal antibody

• 

  WB analysis using 18349-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18349-1-AP (MKRN3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse colon using 18349-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 18349-1-AP (MKRN3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 18349-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 18349-1-AP (MKRN3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 18349-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using MKRN3 antibody (18349-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

MKRN3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 18349-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

D15S9, makorin ring finger protein 3, MKRN3, RING finger protein 63, RNF63, ZFP127, Zinc finger protein 127, ZNF127

---

Tested Applications

• Positive WB detected in: mouse liver tissue
• Positive IHC detected in: mouse colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

18349-1-AP targets MKRN3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13167

  Product name: Recombinant human MKRN3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 167-507 aa of BC044639

  Sequence: SLPVIGSAAERGFFEAERDNADRGAAGGAGVESWADAIEFVPGQPYRGRWVASAPEAPLQSSETERKQMAVGSGLRFCYYASRGVCFRGESCMYLHGDICDMCGLQTLHPMDAAQREEHMRACIEAHEKDMELSFAVQRGMDKVCGICMEVVYEKANPNDRRFGILSNCNHSFCIRCIRRWRSARQFENRIVKSCPQCRVTSELVIPSEFWVEEEEEKQKLIQQYKEAMSNKACRYFAEGRGNCPFGDTCFYKHEYPEGWGDEPPGPGGGSFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLASLLFKRFLSLRDELPFSEDQWDLLHYELEEYFNLIL

• Full Name: makorin ring finger protein 3
• Calculated Molecular Weight: 507 aa, 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC044639
• Gene Symbol: MKRN3
• Gene ID (NCBI): 7681
• RRID: AB_3669299
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13064
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Biochim Biophys Acta Mol Basis Dis; Investigation into the molecular mechanisms of biomarkers in psoriasis vulgaris with reduced high-density lipoprotein levels based on bulk transcriptome sequencing data; Authors - Ying Tu