Tested Applications
| Positive WB detected in | mouse kidney tissue, human kidney tissue, rat kidney tissue |
| Positive IP detected in | Raji cells |
| Positive IHC detected in | human kidney tissue, human renal cell carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
18008-1-AP targets Neprilysin/CD10 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12506 Product name: Recombinant human MME,CD10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC106070 Sequence: MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSSDCIKSGMVARAYNPRGRRIA Predict reactive species |
| Full Name | membrane metallo-endopeptidase |
| Calculated Molecular Weight | 80aa,9 kDa; 750aa,85 kDa |
| Observed Molecular Weight | 100 kDa |
| GenBank Accession Number | BC106070 |
| Gene Symbol | CD10 |
| Gene ID (NCBI) | 4311 |
| RRID | AB_2146541 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08473 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD10, also known as neprilysin, membrane metallo-endopeptidase (MME), neutral endopeptidase (NEP), or common acute lymphoblastic leukemia antigen (CALLA), is a 100-kDa type II transmembrane glycoprotein belonging to peptidase M13 family (PMID: 7760013; 8102558). Among hematopoietic cells, CD10 is expressed on granulocytes, B cell precursors, mature germinal center B cells, a subset of immature thymocytes (PMID: 13679451). CD10 is also expressed on a variety of nonhematopoietic cell types, including bronchial epithelial cells, cultured fibroblasts, bone marrow stromal cells, renal proximal tubular epithelial cells, breast myoepithelium, biliary canaliculi (PMID: 8102558). CD10 is a cell surface peptidase that cleaves peptide bonds on the amino side of hydrophobic amino acids and inactivates a variety of physiologically active peptides. Loss or decreases in CD10 expression have been reported in a variety of malignancies (PMID: 16054017).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Neprilysin/CD10 antibody 18008-1-AP | Download protocol |
| IHC protocol for Neprilysin/CD10 antibody 18008-1-AP | Download protocol |
| IP protocol for Neprilysin/CD10 antibody 18008-1-AP | Download protocol |
| WB protocol for Neprilysin/CD10 antibody 18008-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-MME (Neprilysin) Affinity Purified Antibody (Cat# 18008-1-AP) has 34 total citations spanning journals including Adv Sci, Brain, NPJ Aging, Aging Cell, J Alzheimers Dis, Mol Hum Reprod, Sci Rep, iScience, and J Nephrol. Research fields cover Alzheimer's disease and amyloid-β pathology, endometriosis, renal fibrosis and diabetic kidney disease, skin aging, cerebral amyloid angiopathy, valvular calcification, and oncology (renal cell carcinoma, CNS lymphoma). Applications include WB, IHC, and IF.
| Species | Application | Title |
|---|---|---|
Adv Mater Noninvasive Optogenetics Realized by iPSC-Derived Tentacled Carrier in Alzheimer's Disease Treatment | ||
Adv Sci (Weinh) Drug Screening of Primary Human Endometriotic Cells Based on Micro-Encapsulating Microfluidic Chip | ||
MedComm (2020) Novel aspect of neprilysin in kidney fibrosis via ACSL4-mediated ferroptosis of tubular epithelial cells | ||
Adv Sci (Weinh) Bone Marrow-Derived GCA+ Immune Cells Drive Alzheimer's Disease Progression | ||
Adv Sci (Weinh) Real-Time in Vivo Monitoring of Circulating Endometrial Cells: Uncovering Systemic Dissemination and Temporal Fluctuations in Endometriosis. | ||
NPJ Aging Decoding skin aging: the role of KNG1 in collagen and elastic fibre degradation. |
Reviews
What customers say
The single available review for 18008-1-AP was submitted by Boyan Zhang in October 2021 for Western Blot (lot 00020124), rated 1 out of 5. The reviewer noted that while the expected molecular weight of the target is approximately 85 kD, the antibody recognized major bands at 60 and 30 kD instead, suggesting the product did not perform as anticipated for their application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Boyan (Verified Customer) (10-04-2021) | calculated size is 85 kd. This antibody recognized major bands at 60, 30 kd.
|
