Neprilysin/CD10 Monoclonal antibody

• 

  WB analysis of human placenta using 60034-1-Ig

  human placenta tissue were subjected to SDS PAGE followed by western blot with 60034-1-Ig (MME,CD10 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

Neprilysin/CD10 Monoclonal Antibody for ELISA

Cat No. 60034-1-Ig

Clone No.4A10H5

Host / Isotype

Mouse / IgM

Reactivity

human

Applications

ELISA

Synonyms

MME, MME,CD10, Enkephalinase, EC:3.4.24.11, CD10

---

Product Information

60034-1-Ig targets Neprilysin/CD10 in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgM
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0427

  Product name: Recombinant human MME,CD10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 52-252 aa of BC101658

  Sequence: YDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISV

• Full Name: membrane metallo-endopeptidase
• Calculated Molecular Weight: 750 aa, 86 kDa
• GenBank Accession Number: BC101658
• Gene Symbol: CD10
• Gene ID (NCBI): 4311
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Caprylic Acid-Ammonium Sulfate Precipitation
• UNIPROT ID: P08473
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MME is also names as neprilysin,CALLA,NEP,SFE,CD10 and belongs to the peptidase M13 family.It is a glycoprotein that is particularly abundant in kidney, where it is present on the brush border of proximal tubules and on glomerular epithelium.CD10 has been considered a useful marker in the diagnosis of renal carcinomas, because of its expression in clear cell and papillary renal cell carcinomas and its absence in chromophobe renal cell carcinomas(PMID:15286660).