Tested Applications
| Positive WB detected in | HeLa cells, MCF-7 cells, MDA-MB-453s cells, mouse liver tissue, rat liver tissue, HepG2 cells |
| Positive IP detected in | MCF-7 cells |
| Positive IHC detected in | human liver tissue, human hepatocirrhosis tissue, mouse liver tissue, human liver cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
18165-1-AP targets MMP13 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, rabbit, zebrafish, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12653 Product name: Recombinant human MMP13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 100-471 aa of BC074808 Sequence: DVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC Predict reactive species |
| Full Name | matrix metallopeptidase 13 |
| Calculated Molecular Weight | 471 aa, 54 kDa |
| Observed Molecular Weight | 65-70 kDa, 50-55 kDa, 40 kDa |
| GenBank Accession Number | BC074808 |
| Gene Symbol | MMP13 |
| Gene ID (NCBI) | 4322 |
| RRID | AB_2144858 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P45452 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MMP-13(Matrix metalloproteinase-13), cleaves type I collagen and was previously thought to be the rodent analogue of human interstitial MMP-1. MMP-13 is found in hypertrophic and calcifying cartilage of mammalian growth plate. The bands seen with rat MMP-13 are consistent with a 59-kDa latent form and a 43-kDa active form reported for this enzyme, along with a smaller band at approximately 30 kDa(PMID:10771523). It also can be detected 3 bands that the glycosylated proMMP-13 (70 kDa), unglycosylated proform (55 kDa), and active MMP-13 enzyme (40kDa) by western blot(PMID:18332263).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MMP13 antibody 18165-1-AP | Download protocol |
| IHC protocol for MMP13 antibody 18165-1-AP | Download protocol |
| IP protocol for MMP13 antibody 18165-1-AP | Download protocol |
| WB protocol for MMP13 antibody 18165-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MMP13 polyclonal antibody (Cat# 18165-1-AP) has accumulated 844 citations across high-impact journals including Nature, Nature Communications, Science Advances, Cell Metabolism, Biomaterials, Advanced Science, Acta Biomaterialia, Theranostics, and Phytomedicine. The cited research is predominantly focused on osteoarthritis, intervertebral disc degeneration, cartilage regeneration, rheumatoid arthritis, and bone biology, with significant applications in nanomedicine, hydrogel-based delivery systems, and extracellular vesicle therapies.
| Species | Application | Title |
|---|---|---|
Nat Nanotechnol A disease-severity-responsive nanoparticle enables potent ghrelin messenger RNA therapy in osteoarthritis. | ||
Cell Metab Semaglutide ameliorates osteoarthritis progression through a weight loss-independent metabolic restoration mechanism. | ||
Immunity A bladder-blood immune barrier constituted by suburothelial perivascular macrophages restrains uropathogen dissemination | ||
Exploration (Beijing) Matching TGF-β1 Activation With Stress-Responsive Charge-Reversal Hydrogel Microspheres for the Treatment of Osteoarthritis. |
Reviews
What customers say
Both reviewers gave 5-star ratings. One user reported good IHC staining on rat knee joint tissue at a 1:100 dilution for MMP13 detection. Another user confirmed clear Western blot bands on liver tissue at a 1:1000 dilution. Overall, the antibody is well-received for both IHC and WB applications, delivering reliable and specific results across different species and tissues.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Xie (Verified Customer) (05-13-2021) | Good IHC staining for Rat MMP13.
 |
Hongxue (Verified Customer) (01-12-2021) | clear wb band
 |
