• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated MMP13 Polyclonal antibody

MMP13 Polyclonal Antibody for IF/ICC
Cat No. CL488-18165

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

MMP 13, Matrix metalloproteinase-13, Matrix metalloproteinase 13, EC:3.4.24.-, Collagenase 3

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-18165 targets MMP13 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12653

Product name: Recombinant human MMP13 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 100-471 aa of BC074808

Sequence: DVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC

Predict reactive species
Full Name matrix metallopeptidase 13
Calculated Molecular Weight 471 aa, 54 kDa
Observed Molecular Weight 65-70 kDa, 50-55 kDa, 40 kDa
GenBank Accession NumberBC074808
Gene Symbol MMP13
Gene ID (NCBI) 4322
RRIDAB_3672691
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP45452
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MMP-13(Matrix metalloproteinase-13), cleaves type I collagen and was previously thought to be the rodent analogue of human interstitial MMP-1. MMP-13 is found in hypertrophic and calcifying cartilage of mammalian growth plate. The bands seen with rat MMP-13 are consistent with a 59-kDa latent form and a 43-kDa active form reported for this enzyme, along with a smaller band at approximately 30 kDa(PMID:10771523). It also can be detected 3 bands that the glycosylated proMMP-13 (70 kDa), unglycosylated preform (55 kDa), and active MMP-13 enzyme (40kDa) by western blot(PMID:18332263).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 MMP13 antibody CL488-18165Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...