Tested Applications
| Positive WB detected in | SH-SY5Y cells, human placenta tissue |
| Positive IP detected in | human placenta tissue |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 9 publications below |
| IHC | See 2 publications below |
Product Information
14244-1-AP targets MMP19 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5501 Product name: Recombinant human MMP19 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 207-508 aa of BC050368 Sequence: RIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPTEPSPMPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKGLFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNISHNWMHCRPRTIDTTPSGGNTTPSGTGITLDTTLSATETTFEY Predict reactive species |
| Full Name | matrix metallopeptidase 19 |
| Calculated Molecular Weight | 57 kDa |
| Observed Molecular Weight | 57-60 kDa |
| GenBank Accession Number | BC050368 |
| Gene Symbol | MMP19 |
| Gene ID (NCBI) | 4327 |
| RRID | AB_10637857 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99542 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MMP19(matrix metalloproteinase-19) has the capacity to degrade several basement membrane proteins such as type IV collagen, laminin, tenascin C, and nidogen. It is expressed by microvascular endothelial cells in vitro as well as by capillaries in the inflamed synovial membrane, whereas its expression is absent in quiescent macrovascular endothelial cells of large arteries and veins . And it is also detected in capillaries of normal mammary tissue, benign mammary carcinomas and in skin capillaries(PMID:15241558).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MMP19 antibody 14244-1-AP | Download protocol |
| IHC protocol for MMP19 antibody 14244-1-AP | Download protocol |
| IP protocol for MMP19 antibody 14244-1-AP | Download protocol |
| WB protocol for MMP19 antibody 14244-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Bioact Mater Profibrogenic macrophage-targeted delivery of mitochondrial protector via exosome formula for alleviating pulmonary fibrosis | ||
J Mol Cell Cardiol MMP19 in vascular smooth muscle cells protects against thoracic aortic aneurysm and dissection via the MMP19/Aggrecan/Wnt/β-catenin axis
| ||
Cancer Gene Ther A critical ETV4/Twist1/Vimentin axis in Ha-RAS-induced aggressive breast cancer. | ||
J Cell Biochem MicroRNA-193b-3p Regulates Matrix Metalloproteinase 19 Expression in Interleukin-1β-Induced Human Chondrocytes. | ||
Front Pharmacol METTL3/m6A/IFIT2 regulates proliferation, invasion and immunity in esophageal squamous cell carcinoma | ||
J Biochem Mol Toxicol Pacenta polypeptide injection alleviates the fibrosis and inflammation in cigarette smoke extracts-induced BEAS-2B cells by modulating MMP-9/TIMP-1 signaling |











