MOBKL1B Polyclonal antibody, PBS Only

• 

  WB analysis of K-562 using 11669-1-AP (same clone as 11669-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 11669-1-AP (MOBKL1B Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11669-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 11669-1-AP (same clone as 11669-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11669-1-AP (MOBKL1B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11669-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 11669-1-AP (same clone as 11669-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 11669-1-AP (MOBKL1B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11669-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A375 using 11669-1-AP (same clone as 11669-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 11669-1-AP (MOBKL1B Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11669-1-PBS in a different storage buffer formulation.

MOBKL1B Polyclonal Antibody for WB, ELISA

Cat No. 11669-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

---

Product Information

11669-1-PBS targets MOBKL1B in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2252

  Product name: Recombinant human MOBKL1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-216 aa of BC003398

  Sequence: MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR

• Full Name: MOB1, Mps One Binder kinase activator-like 1B (yeast)
• Calculated Molecular Weight: 216 aa, 25 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC003398
• Gene Symbol: MOBKL1B
• Gene ID (NCBI): 55233
• RRID: AB_10597231
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H8S9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.