MOBKL3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MOBKL3 Polyclonal antibody (15886-1-AP)

MOBKL3 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 15886-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

2C4D, CGI-95, MOB4, Mps one binder kinase activator-like 3, PHOCN

• 

  WB analysis of K-562 using 15886-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 15886-1-AP (MOBKL3 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of K-562 using 15886-1-AP

  IP result of anti-MOBKL3 (IP:15886-1-AP, 4ug; Detection:15886-1-AP 1:300) with K-562 cells lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 15886-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15886-1-AP (MOBKL3 antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 15886-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15886-1-AP (MOBKL3 antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 15886-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 15886-1-AP (MOBKL3 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 15886-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 15886-1-AP (MOBKL3 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human colon cancer using 15886-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human colon cancer tissue using MOBKL3 antibody (15886-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human colon cancer using 15886-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human colon cancer tissue using MOBKL3 antibody (15886-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: K-562 cells
• Positive IP detected in: K-562 cells
• Positive IHC detected in: human colon cancer tissue, human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human colon cancer tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:600-1:2400
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15886-1-AP targets MOBKL3 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8671

  Product name: Recombinant human MOBKL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-225 aa of BC005237

  Sequence: MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA

• Full Name: MOB1, Mps One Binder kinase activator-like 3 (yeast)
• Calculated Molecular Weight: 225 aa, 26 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC005237
• Gene Symbol: MOBKL3
• Gene ID (NCBI): 25843
• RRID: AB_10858478
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3A3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Adv Sci (Weinh); Identification of PKN2 and MOB4 as Coordinators of Collective Cell Migration.; Authors - Artem I Fokin ; KO Validated