GCS1 Polyclonal antibody

• 

  WB analysis using 17859-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 17859-1-AP (GCS1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 17859-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 17859-1-AP (GCS1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human small intestine using 17859-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine using 17859-1-AP (GCS1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human small intestine using 17859-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine using 17859-1-AP (GCS1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human small intestine using 17859-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine using 17859-1-AP (GCS1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human small intestine using 17859-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine using 17859-1-AP (GCS1 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human liver using 17859-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 17859-1-AP (GCS1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver using 17859-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 17859-1-AP (GCS1 antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

GCS1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17859-1-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IF, IHC, CoIP, ELISA

Synonyms

GCS1, glucosidase I, MOGS, Processing A glucosidase I

---

Tested Applications

• Positive WB detected in: COLO 320 cells
• Positive IHC detected in: human small intestine tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 7 publications below
• IHC: See 2 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

17859-1-AP targets GCS1 in WB, IF, IHC, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12321

  Product name: Recombinant human MOGS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 492-837 aa of BC028337

  Sequence: DEARARVPPEFLVQRAVHANPPTLLLPVAHMLEVGDPDDLAFLRKALPRLHAWFSWLHQSQAGPLPLSYRWRGRDPALPTLLNPKTLPSGLDDYPRASHPSVTERHLDLRCWVALGARVLTRLAEHLGEAEVAAELGPLAASLEAAESLDELHWAPELGVFADFGNHTKAVQLKPRPPQGLVRVVGRPQPQLQYVDALGYVSLFPLLLRLLDPTSSRLGPLLDILADSRHLWSPFGLRSLAASSSFYGQRNSEHDPPYWRGAVWLNVNYLALGALHHYGHLEGPHQARAAKLHGELRANVVGNVWRQYQATGFLWEQYSDRDGRGMGCRPFHGWTSLVLLAMAEDY

• Full Name: mannosyl-oligosaccharide glucosidase
• Calculated Molecular Weight: 837 aa, 92 kDa
• Observed Molecular Weight: 80-92 kDa
• GenBank Accession Number: BC028337
• Gene Symbol: GCS1
• Gene ID (NCBI): 7841
• RRID: AB_10694270
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13724
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MOGS (Mannosyl-oligosaccharide glucosidase), also known as GCS1, is the first enzyme in the N-linked oligosaccharide processing pathway. The enzyme cleaves the distal alpha-1,2-linked glucose residue from the Glc(3)-Man(9)-GlcNAc(2) oligosaccharide precursor (PMID: 38187061). The resulting Glc(2)-Man(9)-GlcNAc(2) intermediate is then further modified by glucosidase II and several ER- and Golgi-resident mannosidases and glycosyltransferases, finally yielding a complex array of glycan structures (PMID: 3896128). MOGS has two isoforms, and it is located in the lumen of the endoplasmic reticulum.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	J Cell Biol; Competition for calnexin binding regulates secretion and turnover of misfolded GPI-anchored proteins; Authors - Amber M Cheatham
human	WB	PLoS Pathog; Identification of cell type specific ACE2 modifiers by CRISPR screening.; Authors - Emily J Sherman
	WB	Int J Mol Sci; The Expression Pattern of p32 in Sheep Muscle and Its Role in Differentiation, Cell Proliferation, and Apoptosis of Myoblasts.; Authors - Jianyu Ma
human	WB,IHC	Front Genet; Subtypes analysis and prognostic model construction based on lysosome-related genes in colon adenocarcinoma; Authors - Yang Chen
human	WB	Am J Physiol Cell Physiol; Hydrogen Sulfide Accumulates LDL Receptor Precursor via Downregulating PCSK9 in HepG2 Cells.; Authors - Yong Huang
human	IF	Neurogenetics; Identification and characterization of novel mutations in MOGS in a Chinese patient with infantile spams.; Authors - Xuehua Peiwei Zhao