MOSPD1 Polyclonal antibody

MOSPD1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 32307-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Motile sperm domain-containing protein 1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMDA-MB-231 cells, PC-3 cells
Positive IHC detected inmouse cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

32307-1-AP targets MOSPD1 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag37532

Product name: Recombinant human MOSPD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-213 aa of BC005700

Sequence: MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKEQQKEEEEKRLKEHLTESLFFEQSFQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGDVESLVPLYLHLSVNQKLVAAYILGLITMAILRT

Predict reactive species
Full Name motile sperm domain containing 1
Calculated Molecular Weight 24 kDa
Observed Molecular Weight25 kDa
GenBank Accession NumberBC005700
Gene Symbol MOSPD1
Gene ID (NCBI) 56180
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ9UJG1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MOSPD1, or Motile Sperm Domain-Containing Protein 1, is a protein that has been implicated in various biological processes. It is part of a family of proteins characterized by the presence of the major sperm protein domain and two transmembrane domains (PMID: 21792907). The protein is primarily located in the endoplasmic reticulum and Golgi apparatus, and it can also be found in the nucleus under certain conditions. MOSPD1 plays a significant role in the differentiation and proliferation of mesenchymal stem cells (MSCs). Studies have shown that MOSPD1-null embryonic stem cells exhibit impaired differentiation into various cell lineages, including osteoblasts and adipocytes, indicating its importance in MSC proliferation and differentiation (PMID: 26175344). Additionally, MOSPD1 is involved in the switch between mesenchymal and epithelial cells, suggesting its role in developmental regulation.

Protocols

Product Specific Protocols
WB protocol for MOSPD1 antibody 32307-1-APDownload protocol
IHC protocol for MOSPD1 antibody 32307-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...