Tested Applications
Positive IHC detected in | rat dorsal root ganglion tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
17946-1-AP targets MRGPRX3 in IHC, ELISA applications and shows reactivity with human, rat samples.
Tested Reactivity | human, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12417 Product name: Recombinant human MRGPRX3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 240-322 aa of BC067292 Sequence: SRIHLDWKVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDTPEVDEGGGQLPQETLELSGSRLEQ Predict reactive species |
Full Name | MAS-related GPR, member X3 |
Calculated Molecular Weight | 322 aa, 36 kDa |
GenBank Accession Number | BC067292 |
Gene Symbol | MRGPRX3 |
Gene ID (NCBI) | 117195 |
RRID | AB_3669284 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96LB0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MRGPRX3 (Mas-related G-protein coupled receptor member X3) is a member of the mas-related/sensory neuron specific subfamily of G protein coupled receptors. MRGPRX3 may be involved in sensory neuron regulation and in the modulation of pain.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for MRGPRX3 antibody 17946-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |