MRP63 Polyclonal antibody

• 

  WB analysis of HeLa using 21617-1-AP

  WB result of MRP63 antibody (21617-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MRP63 transfected HeLa cells.

• 

  WB analysis using 21617-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21617-1-AP (MRP63 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 21617-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 21617-1-AP (MRP63 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 21617-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 21617-1-AP (MRP63 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

MRP63 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21617-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

MRPL57, Mitochondrial ribosomal protein L57, Large ribosomal subunit protein mL63, hMRP63, bMRP63

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21617-1-AP targets MRP63 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7289

  Product name: Recombinant human MRP63 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-102 aa of BC000002

  Sequence: MFLTALLWRGRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQERGHAAVRRREAFEAIKAAATSKFPPHRFIADQLDHLNVTKKWS

• Full Name: mitochondrial ribosomal protein 63
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC000002
• Gene Symbol: MRP63
• Gene ID (NCBI): 78988
• RRID: AB_3085663
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BQC6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mitochondrial ribosomal protein 63 is a component of the mitochondrial Large ribosomal subunit (mt-LSU), also known as the Large ribosomal subunit protein mL63.