MRPS18B Polyclonal antibody

MRPS18B Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA
Cat No. 16139-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), IP, CoIP, ELISA

28S ribosomal protein S18-2, mitochondrial, C6orf14, HSPC183, MRP S18 2, MRP S18 b

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, mouse liver tissue, rat heart tissue, HEK-293 cells, MCF-7 cells, PC-3 cells, SH-SY5Y cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman breast cancer tissue, human liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16139-1-AP targets MRPS18B in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9198

Product name: Recombinant human MRPS18B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-258 aa of BC005373

Sequence: MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSSDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL

Predict reactive species
Full Name mitochondrial ribosomal protein S18B
Calculated Molecular Weight 258 aa, 29 kDa
Observed Molecular Weight 29 kDa
GenBank Accession NumberBC005373
Gene Symbol MRPS18B
Gene ID (NCBI) 28973
RRIDAB_2146368
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y676
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MRPS18B, also named as S18mt-b, MRP-S18-2 and C6orf14, belongs to the ribosomal protein S18P family. It is a component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins. This antibody recognizes specifically the 29 kd MRPS18B protein.

Protocols

Product Specific Protocols
WB protocol for MRPS18B antibody 16139-1-APDownload protocol
IHC protocol for MRPS18B antibody 16139-1-APDownload protocol
IP protocol for MRPS18B antibody 16139-1-APDownload protocol
FC protocol for MRPS18B antibody 16139-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell

Mitochondrial Protein Synthesis Adapts to Influx of Nuclear-Encoded Protein.

Authors - Ricarda Richter-Dennerlein
WB

Mol Cell

A kinetic dichotomy between mitochondrial and nuclear gene expression processes

Authors - Erik McShane
WB,CoIP

Cell Host Microbe

Inducible Germline IgMs Bridge Trypanosome Lytic Factor Assembly and Parasite Recognition.

Authors - Joseph Verdi
humanWB

Cell Metab

The mitochondrial RNA-binding protein GRSF1 localizes to RNA granules and is required for posttranscriptional mitochondrial gene expression.

Authors - Antonicka Hana H
humanWB

Nat Struct Mol Biol

Translational control of the cytosolic stress response by mitochondrial ribosomal protein L18.

Authors - Xingqian Zhang
humanWB

Nucleic Acids Res

The human Obg protein GTPBP10 is involved in mitoribosomal biogenesis.

Authors - Elena Lavdovskaia
Loading...
||
New chat Able
正在加载,请稍候...