MRPS18B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MRPS18B Polyclonal antibody (16139-1-AP)

MRPS18B Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA

Cat No. 16139-1-AP Copied!

Publications (64)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), IP, CoIP, ELISA

Synonyms

28S ribosomal protein S18-2, mitochondrial, C6orf14, HSPC183, MRP S18 2, MRP S18 b

• 

  WB analysis using 16139-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16139-1-AP (MRPS18B antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat heart using 16139-1-AP

  rat heart tissue were subjected to SDS PAGE followed by western blot with 16139-1-AP (MRPS18B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 16139-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16139-1-AP (MRPS18B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 16139-1-AP

  IP result of anti-MRPS18B (IP:16139-1-AP, 4ug; Detection:16139-1-AP 1:1000) with HeLa cells lysate 2800ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 16139-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16139-1-AP (MRPS18B antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 16139-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16139-1-AP (MRPS18B antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 16139-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16139-1-AP (MRPS18B antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 16139-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16139-1-AP (MRPS18B antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 16139-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 16139-1-AP (MRPS18B antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 16139-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 16139-1-AP (MRPS18B antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of A549 using 16139-1-AP

  1x10^6 A549 cells were intracellularly stained with 0.4 ug MRPS18B Polyclonal antibody (16139-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MRPS18B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, mouse liver tissue, rat heart tissue, HEK-293 cells, MCF-7 cells, PC-3 cells, SH-SY5Y cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human breast cancer tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16139-1-AP targets MRPS18B in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9198

  Product name: Recombinant human MRPS18B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-258 aa of BC005373

  Sequence: MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSSDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL

• Full Name: mitochondrial ribosomal protein S18B
• Calculated Molecular Weight: 258 aa, 29 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC005373
• Gene Symbol: MRPS18B
• Gene ID (NCBI): 28973
• RRID: AB_2146368
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y676
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MRPS18B, also named as S18mt-b, MRP-S18-2 and C6orf14, belongs to the ribosomal protein S18P family. It is a component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins. This antibody recognizes specifically the 29 kd MRPS18B protein.

Publications

What published studies show

Anti-MRPS18-2 antibody (Cat# 16139-1-AP) has accumulated 64 citations across journals including Cell, Nature Cell Biology, Nature Communications, Molecular Cell, Nucleic Acids Research, Nature Structural & Molecular Biology, PNAS, Cell Reports, EMBO Reports, Oncotarget, Human Molecular Genetics, and others. The research fields covered include mitochondrial ribosome biogenesis and assembly, mitochondrial protein synthesis, mitochondrial diseases, cancer biology (endometrial, prostate, ovarian), RNA processing, respiratory chain assembly, and neurogenetics.

Automatically generated from the 64 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell; Mitochondrial Protein Synthesis Adapts to Influx of Nuclear-Encoded Protein.; Authors - Ricarda Richter-Dennerlein
human	WB	Cell Metab; The mitochondrial RNA-binding protein GRSF1 localizes to RNA granules and is required for posttranscriptional mitochondrial gene expression.; Authors - Antonicka Hana H
	WB,CoIP	Cell Host Microbe; Inducible Germline IgMs Bridge Trypanosome Lytic Factor Assembly and Parasite Recognition.; Authors - Joseph Verdi
human	WB	Nat Cell Biol; Regulators of mitonuclear balance link mitochondrial metabolism to mtDNA expression; Authors - Nicholas J Kramer
human	WB	Nat Commun; Cross-link assisted spatial proteomics to map sub-organelle proteomes and membrane protein topologies; Authors - Ying Zhu
human	WB	Mol Cell; A negative regulator of mitochondrial complex I assembly adapts respiration to cellular energy demand; Authors - Zhirong Li