MRPS2 Polyclonal antibody, PBS Only

• 

  IF Staining of HepG2 using 15907-1-AP (same clone as 15907-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using MRPS2 antibody (15907-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 15907-1-PBS in a different storage buffer formulation.

MRPS2 Polyclonal Antibody for IF/ICC, Indirect ELISA

Cat No. 15907-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, Indirect ELISA

Synonyms

CGI 91, CGI91, CGI-91, COXPD36, MRP S2

---

Product Information

15907-1-PBS targets MRPS2 in IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8513

  Product name: Recombinant human MRPS2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-296 aa of BC008017

  Sequence: MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIRESEDSTDFNDKILNEPLKHSDFFNVKELFSVRSLFDARVHLGHKAGCRHRFMEPYIFGSRLDHDIIDLEQTATHLQLALNFTAHMAYRKGIILFISRNRQFSYLIENMARDCGEYAHTRYFRGGMLTNARLLFGPTVRLPDLIIFLHTLNNIFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGADMSHSL

• Full Name: mitochondrial ribosomal protein S2
• Calculated Molecular Weight: 296 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC008017
• Gene Symbol: MRPS2
• Gene ID (NCBI): 51116
• RRID: AB_10642944
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y399
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.