Product Information
66724-3-PBS targets MRPS27 as part of a matched antibody pair:
MP50532-1: 66724-2-PBS capture and 66724-3-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11047 Product name: Recombinant human MRPS27 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-168 aa of BC030521 Sequence: MPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGASEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA Predict reactive species |
| Full Name | mitochondrial ribosomal protein S27 |
| Calculated Molecular Weight | 168 aa, 19 kDa, 48 kDa |
| GenBank Accession Number | BC030521 |
| Gene Symbol | MRPS27 |
| Gene ID (NCBI) | 23107 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A Magarose purification |
| UNIPROT ID | Q92552 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

