MRPS36 Polyclonal antibody, PBS Only

• 

  IHC staining of human lung cancer using 16279-1-AP (same clone as 16279-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16279-1-AP (MRPS36 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16279-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 16279-1-AP (same clone as 16279-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16279-1-AP (MRPS36 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16279-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 16279-1-AP (same clone as 16279-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16279-1-AP (MRPS36 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16279-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 16279-1-AP (same clone as 16279-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16279-1-AP (MRPS36 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16279-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 16279-1-AP (same clone as 16279-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MRPS36 antibody (16279-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 16279-1-PBS in a different storage buffer formulation.

MRPS36 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 16279-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

S36mt, MRP S36, KGD4, DC47, Alpha-ketoglutarate dehydrogenase subunit 4

---

Product Information

16279-1-PBS targets MRPS36 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9359

  Product name: Recombinant human MRPS36 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-103 aa of BC015966

  Sequence: MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEFIQRGGPE

• Full Name: mitochondrial ribosomal protein S36
• Calculated Molecular Weight: 103 aa, 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC015966
• Gene Symbol: MRPS36
• Gene ID (NCBI): 92259
• RRID: AB_2144247
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P82909
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.