MRPS5 Polyclonal antibody, PBS Only

• 

  WB analysis using 16428-1-AP (same clone as 16428-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 16428-1-AP (MRPS5 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16428-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 16428-1-AP (same clone as 16428-1-PBS)

  WB result of MRPS5 antibody (16428-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-MRPS5 transfected HeLa cells. This data was developed using the same antibody clone with 16428-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 16428-1-AP (same clone as 16428-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16428-1-AP (MRPS5 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 16428-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 16428-1-AP (same clone as 16428-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16428-1-AP (MRPS5 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 16428-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MRPS5 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16428-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

16428-1-PBS targets MRPS5 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9672

  Product name: Recombinant human MRPS5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-430 aa of BC014172

  Sequence: MATAVRAVGCLPVLCSGTAGHLLGRQCSLNTLPAASILAWKSVLGNGHLSSLGTRDTHPYASLSRALQTQCCISSPSHLMSQQYRPYSFFTKLTADELWKGALAETGAGAKKGRGKRTKKKKRKDLNRGQIIGEGRYGFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEADMIQQREEWDRKKKMKVKRERGWSGNSWGGISLGPPDPGPCGETYEDFDTRILEVRNVFTMTAKEGRKKSIRVLVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLHYIERYEDHTIFHDISLRFKRTHIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVSGSINMLSLTQGLFRGLSRQETHQQLADKKGLHVVEIREECGPLPIVVASPRGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLKRAAT

• Full Name: mitochondrial ribosomal protein S5
• Calculated Molecular Weight: 430 aa, 48 kDa
• Observed Molecular Weight: 38-42 kDa
• GenBank Accession Number: BC014172
• Gene Symbol: MRPS5
• Gene ID (NCBI): 64969
• RRID: AB_2878258
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P82675
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.