MRTO4 Polyclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 20194-1-AP (same clone as 20194-1-PBS)

  WB result of MRTO4 antibody (20194-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MRTO4 transfected HEK-293 cells. This data was developed using the same antibody clone with 20194-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human skeletal muscle using 20194-1-AP (same clone as 20194-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 20194-1-AP (MRTO4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20194-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 20194-1-AP (same clone as 20194-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 20194-1-AP (MRTO4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20194-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 20194-1-AP (same clone as 20194-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 20194-1-AP (MRTO4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20194-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 20194-1-AP (same clone as 20194-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20194-1-AP (MRTO4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20194-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MRTO4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20194-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

20194-1-PBS targets MRTO4 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14122

  Product name: Recombinant human MRTO4 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-239 aa of BC003013

  Sequence: MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSGRFQQMGDDLPESASESTEESDSEDDD

• Full Name: mRNA turnover 4 homolog (S. cerevisiae)
• Calculated Molecular Weight: 239 aa, 28 kDa
• Observed Molecular Weight: 28-30 kDa
• GenBank Accession Number: BC003013
• Gene Symbol: MRTO4
• Gene ID (NCBI): 51154
• RRID: AB_10697684
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UKD2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.