MSMB Polyclonal antibody

MSMB Polyclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 15888-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, FC (Intra), ELISA

Beta microseminoprotein, Beta-microseminoprotein, HPC13, Immunoglobulin-binding factor, PSP-94

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman urine sample
Positive IHC detected inhuman lung tissue, human prostate hyperplasia tissue, human kidney tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inLNCaP cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15888-1-AP targets MSMB in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8674

Product name: Recombinant human MSMB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-114 aa of BC005257

Sequence: IPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII

Predict reactive species
Full Name microseminoprotein, beta-
Calculated Molecular Weight 114 aa, 13 kDa
Observed Molecular Weight 15 kDa
GenBank Accession NumberBC005257
Gene Symbol MSMB
Gene ID (NCBI) 4477
RRIDAB_2878197
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP08118
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MSMB is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in the uterus, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer.

Protocols

Product Specific Protocols
FC protocol for MSMB antibody 15888-1-APDownload protocol
IHC protocol for MSMB antibody 15888-1-APDownload protocol
WB protocol for MSMB antibody 15888-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB

Mol Nutr Food Res

Prolonged Fructose Overconsumption Activates Original Biosynthetic and Metabolic Pathways of Endogenous Purine in Rats

Authors - Qiuxia Yu
humanWB,IHC

Front Oncol

WGCNA-ML-MR integration: uncovering immune-related genes in prostate cancer

Authors - Jing Lv
Loading...
||
New chat Able
正在加载,请稍候...