MSMB Polyclonal antibody

• 

  WB analysis using 15888-1-AP

  Human urine samples were subjected to SDS PAGE followed by western blot with 15888-1-AP (MSMB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung using 15888-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 15888-1-AP (MSMB antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 15888-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 15888-1-AP (MSMB antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 15888-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15888-1-AP (MSMB antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 15888-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15888-1-AP (MSMB antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate hyperplasia using 15888-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 15888-1-AP (MSMB antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate hyperplasia using 15888-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 15888-1-AP (MSMB antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 15888-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15888-1-AP (MSMB antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 15888-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15888-1-AP (MSMB antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of LNCaP using 15888-1-AP

  1x10^6 LNCaP cells were intracellularly stained with 0.25 ug MSMB Polyclonal antibody (15888-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

MSMB Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 15888-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

Beta microseminoprotein, Beta-microseminoprotein, HPC13, Immunoglobulin-binding factor, PSP-94

---

Tested Applications

• Positive WB detected in: human urine sample
• Positive IHC detected in: human lung tissue, human prostate hyperplasia tissue, human kidney tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: LNCaP cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

15888-1-AP targets MSMB in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8674

  Product name: Recombinant human MSMB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-114 aa of BC005257

  Sequence: IPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII

• Full Name: microseminoprotein, beta-
• Calculated Molecular Weight: 114 aa, 13 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC005257
• Gene Symbol: MSMB
• Gene ID (NCBI): 4477
• RRID: AB_2878197
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08118
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Front Oncol; WGCNA-ML-MR integration: uncovering immune-related genes in prostate cancer; Authors - Jing Lv
rat	WB	Mol Nutr Food Res; Prolonged Fructose Overconsumption Activates Original Biosynthetic and Metabolic Pathways of Endogenous Purine in Rats; Authors - Qiuxia Yu