Tested Applications
| Positive WB detected in | human urine sample |
| Positive IHC detected in | human lung tissue, human prostate hyperplasia tissue, human kidney tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | LNCaP cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IHC | See 1 publications below |
Product Information
15888-1-AP targets MSMB in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8674 Product name: Recombinant human MSMB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-114 aa of BC005257 Sequence: IPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII Predict reactive species |
| Full Name | microseminoprotein, beta- |
| Calculated Molecular Weight | 114 aa, 13 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC005257 |
| Gene Symbol | MSMB |
| Gene ID (NCBI) | 4477 |
| RRID | AB_2878197 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08118 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MSMB is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in the uterus, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for MSMB antibody 15888-1-AP | Download protocol |
| IHC protocol for MSMB antibody 15888-1-AP | Download protocol |
| WB protocol for MSMB antibody 15888-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Nutr Food Res Prolonged Fructose Overconsumption Activates Original Biosynthetic and Metabolic Pathways of Endogenous Purine in Rats | ||



















