Tested Applications
Positive WB detected in | human urine sample |
Positive IHC detected in | human lung tissue, human prostate hyperplasia tissue, human kidney tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
15888-1-AP targets MSMB in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8674 Product name: Recombinant human MSMB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-114 aa of BC005257 Sequence: IPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII Predict reactive species |
Full Name | microseminoprotein, beta- |
Calculated Molecular Weight | 114 aa, 13 kDa |
Observed Molecular Weight | 15 kDa |
GenBank Accession Number | BC005257 |
Gene Symbol | MSMB |
Gene ID (NCBI) | 4477 |
RRID | AB_2878197 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P08118 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MSMB antibody 15888-1-AP | Download protocol |
IHC protocol for MSMB antibody 15888-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |