MTCL1 Polyclonal antibody

• 

  WB analysis using 25780-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25780-1-AP (MTCL1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of A549 using 25780-1-AP

  IP result of anti-KIAA0802 (IP:25780-1-AP, 4ug; Detection:25780-1-AP 1:400) with A549 cells lysate 640 ug.

MTCL1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 25780-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, canine

Applications

WB, IP, ELISA

Synonyms

SOGA2, KIAA0802, CCDC165

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, MDCK cells
• Positive IP detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25780-1-AP targets MTCL1 in WB, IP, ELISA applications and shows reactivity with human, canine samples.

• Tested Reactivity: human, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22718

  Product name: Recombinant human KIAA0802 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 775-976 aa of BC040542

  Sequence: IDHSPVVQDPFQKGLRAGSRSRSAEPRPELGPGQETGTNSRGRSPSPIGVGSEMCREEGGEGTPVKQDLSAPPGYTLTENVARILNKKLLEHALKEERRQAAHGPPGLHSDSHSLGDTAEPGPMEELPCSALAPSLEPCFSRPERPANRRPPSRWAPHSPTASQPQSPGDPTSLEEHGGEEPPEEQPHRDASLHGLSQYNSL

• Full Name: KIAA0802
• Calculated Molecular Weight: 1905 aa, 209 kDa
• Observed Molecular Weight: 250 kDa
• GenBank Accession Number: BC040542
• Gene Symbol: MTCL1
• Gene ID (NCBI): 23255
• RRID: AB_3669499
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y4B5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Microtubule cross‐linking factor 1 (MTCL1) is a MT‐regulating protein that plays essential roles in accumulating the non-centrosomal MTs into the apicobasal MT bundles. MTCL1, identified as a binding protein of the cell polarity‐regulating kinase, PAR‐1b/MARK2, is recruited to the Golgi membranes through interactions with CLASPs and AKAP450/CG-NAP, and promotes microtubule growth from the Golgi membrane. Western blot analysis detected MTCL1 at an apparent molecular mass of 250 kDa as indicated in the literature (PMID: 23902687, 28283581).