MTERF Polyclonal antibody

• 

  WB analysis of HeLa using 16957-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16957-1-AP (MTERF antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 16957-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16957-1-AP (MTERF antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

MTERF Polyclonal Antibody for WB, ELISA

Cat No. 16957-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

MTERF, MTERF1

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

16957-1-AP targets MTERF in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10640

  Product name: Recombinant human MTERF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-399 aa of BC000965

  Sequence: MQSLSLGQTSISKGLNYLTIMAPGNLWHMRNNFLFGSRCWMTRFSAENIFKSVSFRLFGVKCHNTDSEPLKNEDLLKNLLTMGVDIDMARKRQPGVFHRMITNEQDLKMFLLSKGASKEVIASIISRYPRAITRTPENLSKRWDLWRKIVTSDLEIVNILERSPESFFRSNNNLNLENNIKFLYSVGLTRKCLCRLLTNAPRTFSNSLDLNKQMVEFLQAAGLSLGHNDPTDFVRKIIFKNPFILIQSTKRVKANIEFLRSTFNLNSEELLVLICGPGAEILDLSNDYARRSYANIKEKLFSLGCTEEEVQKFVLSYPDVIFLAEKKFNDKIDCLMEENISISQIIENPRVLDSSISTLKSRIKELVNAGCNLSTLNITLLSWSKKRYEAKLKKLSRFA

• Full Name: mitochondrial transcription termination factor
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC000965
• Gene Symbol: MTERF
• Gene ID (NCBI): 7978
• RRID: AB_2235580
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99551
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mitochondrial transcription termination factor (MTERF)also named as Mterf1 is a 399 amino acid protein, which localizes in the mitochondrion and belongs to the mTERF family. MTERF contains three leucine zippers that form a three-stranded coiled-coil that binds to DNA. It has been suggested that only the phosphorylated form of MTERF has transcription termination activity. MTERF plays a central role in the control of mitochondrial rRNA and mRNA synthesis. MTERFD1 is also thought to act as a mitochondrial transcription regulator and is expressed as two isoforms produced by alternative splicing.Using DNA affinity chromatography, a fraction called MTERF was found to be associated with foot-printing capacity, and this contained two polypeptides of 34 and 31 kDa. Moreover, termination-promoting activity appears to reside in the 34-kDa protein. (PMID:7681833).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Immunol; Kinases Mst1 and Mst2 positively regulate phagocytic induction of reactive oxygen species and bactericidal activity.; Authors - Jing Geng
mouse	WB	Nat Commun; Mice lacking the mitochondrial exonuclease MGME1 accumulate mtDNA deletions without developing progeria.; Authors - Stanka Matic