MTHFD1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MTHFD1 Polyclonal antibody (10794-1-AP)

• Featured Product
• KD/KO Validated

MTHFD1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10794-1-AP Copied!

Publications (21)

Reviews (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

C-1-tetrahydrofolate synthase, cytoplasmic, C-1-tetrahydrofolate synthase, cytoplasmic, N-terminally processed, C1-THF synthase, Epididymis secretory sperm binding protein, MTHFC

• 

  WB analysis using 10794-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10794-1-AP (MTHFD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10794-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10794-1-AP (MTHFD1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10794-1-AP

  WB result of MTHFD1 antibody (10794-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MTHFD1 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10794-1-AP

  HuH-7 cells were subjected to SDS PAGE followed by western blot with 10794-1-AP (MTHFD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 10794-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 10794-1-AP (MTHFD1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse kidney using 10794-1-AP

  IP result of anti-MTHFD1 (IP:10794-1-AP, 5ug; Detection:10794-1-AP 1:600) with mouse kidney tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 10794-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10794-1-AP (MTHFD1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 10794-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10794-1-AP (MTHFD1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 10794-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 10794-1-AP (MTHFD1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 10794-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 10794-1-AP (MTHFD1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10794-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10794-1-AP (MTHFD1 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 10794-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10794-1-AP (MTHFD1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 10794-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10794-1-AP (MTHFD1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10794-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10794-1-AP (MTHFD1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10794-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10794-1-AP (MTHFD1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 10794-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using MTHFD1 antibody (10794-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MTHFD1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HuH-7 cells, human brain tissue, K-562 cells, mouse kidney tissue, MCF-7 cells
• Positive IP detected in: mouse kidney tissue
• Positive IHC detected in: human liver cancer tissue, human colon cancer tissue, mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10794-1-AP targets MTHFD1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1225

  Product name: Recombinant human MTHFD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 536-935 aa of BC009806

  Sequence: TNDRFLRKITIGQAPTEKGHTRTAQFDISVASEIMAVLALTTSLEDMRERLGKMVVASSKKGEPVSAEDLGVSGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSIIADQIALKLVGPEGFVVTEAGFGADIGMEKFFNIKCRYSGLCPHVVVLVATVRALKMHGGGPTVTAGLPLPKAYIQENLELVEKGFSNLKKQIENARMFGIPVVVAVNAFKTDTESELDLISRLSREHGAFDAVKCTHWAEGGKGALALAQAVQRAAQAPSSFQLLYDLKLPVEDKIRIIAQKIYGADDIELLPEAQHKAEVYTKQGFGNLPICMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPGLPTRPCFYDIDLDPETEQVNGLF

• Full Name: methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1, methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthetase
• Calculated Molecular Weight: 101 kDa
• Observed Molecular Weight: 101 kDa
• GenBank Accession Number: BC009806
• Gene Symbol: MTHFD1
• Gene ID (NCBI): 4522
• RRID: AB_2147391
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P11586
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MTHFD1 is a trifunctional enzyme involved in the pathway tetrahydrofolate interconversion, which is part of One-carbon metabolism. MTHFD1 is associated with HCC and CRC progression. It has been reported that MTHFD-deficient patient fibroblasts exhibit enriched MTHFD1 in the nucleus which is critical for de novo dTMP synthesis.(PMID: 31133746, 30997850, 31421459, 25548164)

Publications

What published studies show

Anti-MTHFD2 (cat# 10794-1-AP) has 21 citations published in journals including Nature, Nature Communications, Molecular Cell, PNAS, Developmental Cell, Redox Biology, Cancer Metabolism, and Journal of Pineal Research. Associated research fields span one-carbon metabolism, NADPH redox homeostasis, tumor growth and metastasis, antiviral therapy, fibrosis, cardiac hypertrophy, and nucleotide synthesis.

Automatically generated from the 21 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; Oxidative stress inhibits distant metastasis by human melanoma cells.; Authors - Elena Piskounova ; KD Validated
human	WB	Nat Commun; Mitochondrial one-carbon metabolism is required for TGF-β-induced glycine synthesis and fibrotic responses.; Authors - Angelo Y. Meliton ; KD Validated
human	WB,IF	Nat Commun; Native chromatome profiling reveals hundreds of metabolic enzymes in the nucleus across tissues.; Authors - S. Kourtis
mouse,human	WB,IHC	Nat Commun; Elevating cytosolic NADPH metabolism in endothelial cells ameliorates vascular aging.; Authors - Dan Wu
human	WB	Redox Biol; Cytosolic ME1 integrated with mitochondrial IDH2 supports tumor growth and metastasis.; Authors - Chang Shao
		Mol Cell; Accumulation of succinate suppresses de novo purine synthesis through succinylation-mediated control of the mitochondrial folate cycle.; Authors - Mushtaq A. Nengroo

Reviews

4.5 out of 5

2 verified customer reviews

What customers say

Both reviewers used this antibody for Western Blot and reported positive results. One user (5/5) tested it on human cell lines at 1:1000 dilution, praising it as a great antibody with no background binding. The other (4/5) validated it on liver, kidney, and hippocampus tissues at 1:500 dilution, noting it works well overall. In summary, users find this antibody reliable for WB with clean signals across both cell lines and tissue samples.

Automatically generated from the 2 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Lili (Verified Customer) (02-05-2026)

Great antibody. Works amazing, no background binding.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Human cell lines

MTHFD1 Antibody Western Blot validation (1:1000 dilution) in Human cell lines (Cat no:10794-1-AP)

Hua (Verified Customer) (08-26-2019)

Works well.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: liver, kidney, Hippocampus

MTHFD1 Antibody Western Blot, validation (1:500 dilution) in liver, kidney, Hippocampus (Cat no:10794-1-AP)