Tested Applications
| Positive WB detected in | HEK-293 cells, COLO 320 cells, mouse ovary tissue, HeLa cells, HepG2 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16113-1-AP targets MTHFD1L in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9036 Product name: Recombinant human MTHFD1L protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 427-775 aa of BC017477 Sequence: GRMVVASDKSGQPVTADDLGVTGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSVLADKIALKLVGEEGFVVTEAGFGADIGMEKFFNIKCRASGLVPNVVVLVATVRALKMHGGGPSVTAGVPLKKEYTEENIQLVADGCCNLQKQIQITQLFGVPVVVALNVFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQGFGNLPICMAKTHLSLSHQPDKKGVPRDFILPISDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYDIDLDTETEQVKGLF Predict reactive species |
| Full Name | methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like |
| Calculated Molecular Weight | 978 aa, 106 kDa |
| Observed Molecular Weight | 106 kDa |
| GenBank Accession Number | BC017477 |
| Gene Symbol | MTHFD1L |
| Gene ID (NCBI) | 25902 |
| RRID | AB_2250974 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6UB35 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MTHFD1L(Monofunctional C1-tetrahydrofolate synthase, mitochondrial) is also named as FTHFSDC1(Formyltetrahydrofolate synthetase). MTHFD1L enzyme is present in mitochondria from normal embryonic tissues and embryonic fibroblast cell lines, and embryonic mitochondria possess the ability to synthesize formate from glycine. It catalyzes the final step in the mitochondrial conversion of 1-C units to formate in embryos. Moreover, MTHFD1L levels were substantially higher in embryonic mitochondria than in adult liver mitochondria and embryonic mitochondria exhibited greater formate production(PMID:19948730). It has 2 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MTHFD1L antibody 16113-1-AP | Download protocol |
| IHC protocol for MTHFD1L antibody 16113-1-AP | Download protocol |
| IP protocol for MTHFD1L antibody 16113-1-AP | Download protocol |
| WB protocol for MTHFD1L antibody 16113-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MTHFD1L Polyclonal antibody (Cat# 16113-1-AP) has 23 citations spanning journals including Cell Metabolism, Nature Metabolism, Nature Communications, Molecular Cell, Science Advances, Journal of Experimental Medicine, Cell Reports, Journal of Biological Chemistry, Human Molecular Genetics, Translational Oncology, and others. Research fields cover mitochondrial one-carbon metabolism, folate metabolism, cancer biology (leukemia, melanoma, colorectal cancer), metabolic remodeling, fibrosis, psoriasis, and liver disease.
| Species | Application | Title |
|---|---|---|
Cell Metab Mitochondrial DNA Replication Defects Disturb Cellular dNTP Pools and Remodel One-Carbon Metabolism. | ||
Cell Metab Tumor Reliance on Cytosolic versus Mitochondrial One-Carbon Flux Depends on Folate Availability. | ||
Cell Metab Fibroblast Growth Factor 21 Drives Dynamics of Local and Systemic Stress Responses in Mitochondrial Myopathy with mtDNA Deletions. | ||
Nat Commun Purine nucleotide depletion prompts cell migration by stimulating the serine synthesis pathway.
| ||
Reviews
What customers say
Both reviewers rated this antibody 5 stars for Western Blot at a 1:1000 dilution. One user tested it on human cell lines and described it as a "really great antibody." The other validated it on human ES2 cells, confirming it performed as expected and included a chemiluminescence image of MTHFD1L detection. Both expressed strong satisfaction and willingness to repurchase. Overall, the reviews indicate reliable, specific performance in WB applications with clear signal detection.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Lili (Verified Customer) (01-30-2026) | Really great antibody. Only tested it in western blots.
 |
Furkan Emre (Verified Customer) (02-21-2022) | I am satisfied with the antibody. It worked as I was expecting from it. I would buy it again. I also add a figure showing chemiluminescence detection of MTHFD1L using your antibody.
 |
