MTSS1 Polyclonal antibody

• 

MTSS1 Polyclonal Antibody for ELISA

Cat No. 28265-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

ELISA

Synonyms

DKFZp781P2223, FLJ44694, KIAA0429, metastasis suppressor 1, Metastasis suppressor YGL 1, MIM, MIMA, MIMB, Missing in metastasis protein, MTSS1

---

Product Information

28265-1-AP targets MTSS1 in ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27217

  Product name: Recombinant human MTSS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 345-446 aa of BC023998

  Sequence: PGVLPAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSPRDTPQG

• Full Name: metastasis suppressor 1
• Calculated Molecular Weight: 82 kDa
• GenBank Accession Number: BC023998
• Gene Symbol: MTSS1
• Gene ID (NCBI): 9788
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43312
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.