MXRA8 Polyclonal antibody

• 

  WB analysis using 31581-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31581-1-AP (MXRA8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 31581-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31581-1-AP (MXRA8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

MXRA8 Polyclonal Antibody for WB, ELISA

Cat No. 31581-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Limitrin, MXRA 8

---

Tested Applications

• Positive WB detected in: COS-7 cells, mouse ovary tissue, rat ovary tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31581-1-AP targets MXRA8 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33429

  Product name: Recombinant human MXRA8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 168-308 aa of BC017312

  Sequence: DGEKEVLAVARGAPALLTCVNRGHVWTDRHVEEAQQVVHWDRQPPGVPHDRADRLLDLYASGERRAYGPLFLRDRVAVGADAFERGDFSLRIEPLEVADEGTYSCHLHHHYCGLHERRVFHLTVAEPHAEPPPRGSPGNGS

• Full Name: matrix-remodelling associated 8
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC017312
• Gene Symbol: MXRA8
• Gene ID (NCBI): 54587
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BRK3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.