MYC Polyclonal antibody

MYC Polyclonal Antibody for WB, ELISA
Cat No. 26197-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

bHLHe39, c Myc, MRTL, MYC, Myc proto oncogene protein, Proto oncogene c Myc, Transcription factor p64

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse embryo tissue, HeLa cells, human placenta tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26197-1-AP targets MYC in WB, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24299

Product name: Recombinant human MYC protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 378-454 aa of BC000141

Sequence: ERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA

Predict reactive species
Full Name v-myc myelocytomatosis viral oncogene homolog (avian)
Calculated Molecular Weight 49 kDa
Observed Molecular Weight 65-70 kDa
GenBank Accession NumberBC000141
Gene Symbol MYC
Gene ID (NCBI) 4609
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01106
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MYC contains one basic helix-loop-helix (bHLH) domain. This protein is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. It seems to activate the transcription of growth-related genes. It binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. This antibody is a rabbit polyclonal antibody raised against recombinant protein of human MYC.The 50kDa band recognized by antibody is the native form of MYC, while the other bands, between 60-70kDa, are the phosphorylated form of MYC [PMID: 12189186]

Loading...
||
New chat

Able

正在加载,请稍候...