Tested Applications
Positive WB detected in | human placenta tissue, SKOV-3 cells, C6 cells, mouse brain tissue, SH-SY5Y cells, rat brain tissue |
Positive IHC detected in | human thyroid cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 12 publications below |
IHC | See 10 publications below |
IF | See 1 publications below |
Product Information
10159-2-AP targets MYCN in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0193 Product name: Recombinant human MYCN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 289-464 aa of BC002712 Sequence: SNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLKSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC Predict reactive species |
Full Name | v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian) |
Calculated Molecular Weight | 50 kDa |
Observed Molecular Weight | 65-70 kDa |
GenBank Accession Number | BC002712 |
Gene Symbol | MYCN |
Gene ID (NCBI) | 4613 |
RRID | AB_2266881 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P04198 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MYCN, also named as BHLHE37 and NMYC, is a transcription factor. It is primarily expressed in normal developing embryos and is thought to be critical in brain and other neural development. It is often amplified in human neuroblastomas. IR34A can suppress MYCN expression, it suggest MYCN has a role in cell growth. The expression of the MCYN is upregulated in a variety of human tumors, most frequently neuroblastoma, where the level of expression appears to increase as the tumor progresses. The calculated molecuar weight of MYCN is 50 kDa, but Phosphorylated MYCN is about 65-70 kDa. MYCN exsits two isoforms and MV of isoform is respectively 65 kDa and 45 kDa. (PMID: 19615087 )
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MYCN antibody 10159-2-AP | Download protocol |
IHC protocol for MYCN antibody 10159-2-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Elife Combined ALK and MDM2 inhibition increases antitumor activity and overcomes resistance in human ALK mutant neuroblastoma cell lines and xenograft models.
| ||
Cancers (Basel) Transcriptomic Analyses of MYCN-Regulated Genes in Anaplastic Wilms' Tumour Cell Lines Reveals Oncogenic Pathways and Potential Therapeutic Vulnerabilities.
| ||
Front Oncol Downregulation of MYCN through PI3K Inhibition in Mouse Models of Pediatric Neural Cancer. | ||
Cancer Neuroblastoma of undifferentiated subtype, prognostic significance of prominent nucleolar formation, and MYC/MYCN protein expression: a report from the Children's Oncology Group. | ||
Front Cell Dev Biol An E2F5-TFDP1-BRG1 Complex Mediates Transcriptional Activation of MYCN in Hepatocytes. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH CHAO (Verified Customer) (03-31-2022) | Strong bands.
|
FH Tom (Verified Customer) (08-22-2020) | I saw a specific ~60 kDa band when performing western blots using this MYCN antibody. The band is bigger than molecular weight of MYCN, probably due to post-translational modifications.
|
FH Tom (Verified Customer) (08-22-2020) | I performed immunofluorescence using this antibody. I observed very strong MYCN signal in mouse heart tissue sections. However, I saw cytoplasmic staining in addition to nuclear staining. It is probably due to MYCN's localization to both cytoplasm and nuclei or this antibody has some background staining.
|
FH Jessica (Verified Customer) (10-31-2018) | Strongest band observed was around 60 kDa with some much weaker bands much higher and much lower observable with higher exposures. Ab had affinity for BE2C cell lysate, but did not bind the c-myc expressed in Sy5Y cells on the same blot. I used 2 % skim milk PBST for incubation. As MYCN Abs go this one is pretty good!
|