MYL6B Polyclonal antibody, PBS Only

• 

  WB analysis using 16963-1-AP (same clone as 16963-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16963-1-AP (MYL6B antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16963-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 16963-1-AP (same clone as 16963-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 16963-1-AP (MYL6B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16963-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 16963-1-AP (same clone as 16963-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 16963-1-AP (MYL6B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16963-1-PBS in a different storage buffer formulation.

MYL6B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16963-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

16963-1-PBS targets MYL6B in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10683

  Product name: Recombinant human MYL6B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-208 aa of BC012425

  Sequence: MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV

• Full Name: myosin, light chain 6B, alkali, smooth muscle and non-muscle
• Calculated Molecular Weight: 208 aa, 23 kDa
• Observed Molecular Weight: 22-25 kDa
• GenBank Accession Number: BC012425
• Gene Symbol: MYL6B
• Gene ID (NCBI): 140465
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14649
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MYL6B, also known as MLC1SA, is primarily found in a hexamer consisting of four light chains and two heavy chains. MYL6B is an essential light chain for non-muscle Myosin II (NMII) that is involved in the control of cell adhesion, cell migration and tissue architecture, cargo transport, and endocytosis (PMID: 29439719, 33817240).