MYO1G Polyclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 25772-1-AP (same clone as 25772-1-PBS)

  WB result of MYO1G antibody (25772-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MYO1G transfected Jurkat cells. This data was developed using the same antibody clone with 25772-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 25772-1-AP (same clone as 25772-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25772-1-AP (MYO1G antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25772-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 25772-1-AP (same clone as 25772-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using MYO1G antibody (25772-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25772-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MYO1G Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 25772-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

HA 2, Minor histocompatibility antigen HA-2, myosin IG, Unconventional myosin-Ig

---

Product Information

25772-1-PBS targets MYO1G in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22696

  Product name: Recombinant human MYO1G protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 190-391 aa of BC113544

  Sequence: RVLKQHVGERNFHAFYQLLRGSEDKQLHELHLERNPAVYNFTHQGAGLNMTVHSALDSDEQSHQAVTEAMRVIGFSPEEVESVHRILAAILHLGNIEFVETEEGGLQKEGLAVAEEALVDHVAELTATPRDLVLRSLLARTVASGGRELIEKGHTAAEASYARDACAKAVYQRLFEWVVNRINSVMEPRGRDPRRDGKDTVI

• Full Name: myosin IG
• Calculated Molecular Weight: 1018 aa, 116 kDa
• Observed Molecular Weight: 110-120 kDa
• GenBank Accession Number: BC113544
• Gene Symbol: MYO1G
• Gene ID (NCBI): 64005
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: B0I1T2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MYO1G is a plasma membrane-associated class I myosin that is abundant in T and B lymphocytes and mast cells and expressed specifically in the haematopoietic system. Class I myosins have been implicated in various cellular processes relying on actin-dependent membrane dynamics such as endocytosis, secretion, adhesion, motility and regulation of mechanosensitive channels (PMID: 19968988). MYO1G localizes to the plasma membrane linked to PIP2 and PIP3, is particularly enriched at cell-surface microvilli, and associates in an ATP-releasable manner to the actin cytoskeleton (PMID: 24310084). MYO1G can be detected as about 110-120 kDa.