Tested Applications
Positive IF-P detected in | mouse liver tissue |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-66272 targets MCP-1/CCL2 in IF-P applications and shows reactivity with mouse samples.
Tested Reactivity | mouse |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24085 Product name: Recombinant mouse Mcp1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 24-148 aa of NM-011333 Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN Predict reactive species |
Full Name | chemokine (C-C motif) ligand 2 |
Observed Molecular Weight | 26 kDa |
GenBank Accession Number | NM-011333 |
Gene Symbol | MCP-1/CCL2 |
Gene ID (NCBI) | 20296 |
RRID | AB_2934454 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P10148 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Monocyte chemoattractant protein-1 (MCP-1/CCL2) is one of the key chemokines that regulate migration and infiltration of monocytes/macrophages. Both CCL2 and its receptor CCR2 have been demonstrated to be induced and involved in various diseases. Migration of monocytes from the blood stream across the vascular endothelium is required for routine immunological surveillance of tissues, as well as in response to inflammation.
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 488 MCP-1/CCL2 antibody CL488-66272 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |