CoraLite® Plus 488-conjugated MCP-1/CCL2 Monoclonal antibody

• 

  IF Staining of mouse liver using CL488-66272

  Immunofluorescent analysis of (4% PFA) fixed mouse liver tissue using CoraLite® Plus 488 Mcp1 antibody (CL488-66272, Clone: 1B9F7 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

MCP-1/CCL2 Monoclonal Antibody for IF-P

Cat No. CL488-66272

Clone No.1B9F7

Host / Isotype

Mouse / IgG1

Reactivity

mouse

Applications

IF-P

Synonyms

Ccl2, Mcp1, MCP-1, chemokine (C C motif) ligand 2, CCL-2

---

Tested Applications

• Positive IF-P detected in: mouse liver tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66272 targets MCP-1/CCL2 in IF-P applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24085

  Product name: Recombinant mouse Mcp1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 24-148 aa of NM-011333

  Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN

• Full Name: chemokine (C-C motif) ligand 2
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: NM-011333
• Gene Symbol: MCP-1/CCL2
• Gene ID (NCBI): 20296
• RRID: AB_2934454
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P10148
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Monocyte chemoattractant protein-1 (MCP-1/CCL2) is one of the key chemokines that regulate migration and infiltration of monocytes/macrophages. Both CCL2 and its receptor CCR2 have been demonstrated to be induced and involved in various diseases. Migration of monocytes from the blood stream across the vascular endothelium is required for routine immunological surveillance of tissues, as well as in response to inflammation.