Tested Applications
Positive WB detected in | L02 cells, mouse liver tissue, mouse spleen tissue, rat spleen tissue |
Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 18 publications below |
IHC | See 2 publications below |
IF | See 1 publications below |
Product Information
26469-1-AP targets Mitoferrin 1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24876 Product name: Recombinant human SLC25A37 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-44 aa of BC132799 Sequence: MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSAS Predict reactive species |
Full Name | solute carrier family 25, member 37 |
Observed Molecular Weight | 37 kDa |
GenBank Accession Number | BC132799 |
Gene Symbol | Mitoferrin 1 |
Gene ID (NCBI) | 51312 |
RRID | AB_2880527 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NYZ2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Mitoferrin 1 antibody 26469-1-AP | Download protocol |
IHC protocol for Mitoferrin 1 antibody 26469-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Redox Biol Mitochondrial ferritin alleviates apoptosis by enhancing mitochondrial bioenergetics and stimulating glucose metabolism in cerebral ischemia reperfusion | ||
Biomed Pharmacother The roles and mechanisms of CDGSH iron-sulfur domain 1 in kainic acid-induced mitochondrial iron overload, dysfunction and neuronal damage | ||
Int J Mol Sci Contemporary Antiretroviral Therapy Dysregulates Iron Transport and Augments Mitochondrial Dysfunction in HIV-Infected Human Microglia and Neural-Lineage Cells | ||
J Neurochem Cell density impacts the susceptibility to ferroptosis by modulating IRP1-mediated iron homeostasis | ||
Sci Rep Imbalance of redox homeostasis and altered cellular signaling induced by the metal complexes of terpyridine |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Rahul (Verified Customer) (07-23-2025) | Works well to detect Mitoferrin1 even with a couple thousand cells (pretty sensitive).
![]() |