Mmp9 Recombinant monoclonal antibody

• 

  IHC staining of mouse spleen using 82854-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 82854-5-RR (Mmp9 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 82854-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 82854-5-RR (Mmp9 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 82854-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 82854-5-RR (Mmp9 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 82854-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 82854-5-RR (Mmp9 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of RAW 264.7 using 82854-5-RR

  1x10^6 unstimulated or LPS and BFA treated RAW 264.7 cells were intracellularly stained with 0.13 ug Anti-Mouse Mmp9 (82854-5-RR, Clone:230069F1) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:700. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• 

  Affinity and Kinetic Characterization of 82854-5-RR

  Biolayer interferometry (BLl) kinetic assays of 82854-5-RR against Human Mmp9 were performed. The affinity constant is 76.6 pM.

Mmp9 Uni-rAb^® Recombinant Antibody for IHC, FC (Intra), ELISA

Cat No. 82854-5-RR

Clone No.230069F1

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, FC (Intra), ELISA

Synonyms

230069F1, AW743869, B/MMP9, Clg4b, matrix metallopeptidase 9

---

Tested Applications

• Positive IHC detected in: mouse spleen tissue, mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: 100ng/ml LPS+BFA RAW 264.7 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.13 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82854-5-RR targets Mmp9 in IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0452

  Product name: Recombinant Mouse MMP-9 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 20-730 aa of NM_013599

  Sequence: APYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRLGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDHEVNQVDDVGYVTYDLLQCP

• Full Name: matrix metallopeptidase 9
• Calculated Molecular Weight: 81kd
• Observed Molecular Weight: 92-100 kDa
• GenBank Accession Number: NM_013599
• Gene Symbol: Mmp9
• Gene ID (NCBI): 17395
• RRID: AB_3670579
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P41245-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mmp9 (matrix metallopeptidase 9), also known as Clg4b. It is expected to be located inextracellular matrix. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, tissue remodeling, and disease processes, such as arthritis or metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. Studies in rhesus monkeys suggest that MMP9 is involved in IL-8-induced mobilization hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. The pro-MMP9 is 92 kDa, and it can be detected a processed form of 68 kDa. This protein can exist as a dimer of 180 kDa (PMID:7492685).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	FC (Intra)	Commun Biol; The crosstalk of monocyte-neutrophil in hair follicles regulates neutrophil transepidermal migration in contact dermatitis; Authors - Zhan Fan